BLASTX nr result
ID: Ephedra28_contig00029839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00029839 (452 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006850873.1| hypothetical protein AMTR_s00025p00149340 [A... 83 3e-14 >ref|XP_006850873.1| hypothetical protein AMTR_s00025p00149340 [Amborella trichopoda] gi|548854544|gb|ERN12454.1| hypothetical protein AMTR_s00025p00149340 [Amborella trichopoda] Length = 547 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/64 (56%), Positives = 47/64 (73%) Frame = -2 Query: 412 GGDKRSWVKSKNWLKTLDVQSVVKWFDARKKRTRLGDHFATSIEYVLRYSPFVQVKELLV 233 GG +W S+ WL+ LDVQ +V WF +RKK TRLGDHFA IEY LR+SP V++ L++ Sbjct: 3 GGSSENWELSEAWLQELDVQHLVDWFGSRKKNTRLGDHFAACIEYTLRFSPAVKLSNLII 62 Query: 232 SQQV 221 SQQ+ Sbjct: 63 SQQI 66