BLASTX nr result
ID: Ephedra28_contig00029489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00029489 (427 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY07448.1| EF-TU receptor, putative [Theobroma cacao] 62 1e-07 ref|XP_004155230.1| PREDICTED: leucine-rich repeat receptor-like... 56 4e-06 ref|XP_004150938.1| PREDICTED: leucine-rich repeat receptor-like... 56 6e-06 >gb|EOY07448.1| EF-TU receptor, putative [Theobroma cacao] Length = 992 Score = 61.6 bits (148), Expect = 1e-07 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 3/94 (3%) Frame = +2 Query: 2 LLEVMTRKKPTGDAFNGDVSLLQWVSMAIADGEKENLRSIVKNEETVNEEDWEKVEGLLR 181 +LE+ TRK+PT + F GD+ +WVSM + D NL IV +E NE +G+ Sbjct: 902 ILELFTRKRPTDNLFTGDMDFQKWVSMHLPD----NLLDIVDHELLQNEWQPAHSDGIAT 957 Query: 182 V---GLFCCVQDSEKRPTMKEVETLLLMVSGNVS 274 V GL C + E+RPTM+EV ++ V +S Sbjct: 958 VINFGLMCARKSPEERPTMREVSAMIENVKAKLS 991 >ref|XP_004155230.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1-like [Cucumis sativus] Length = 998 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/83 (36%), Positives = 49/83 (59%) Frame = +2 Query: 2 LLEVMTRKKPTGDAFNGDVSLLQWVSMAIADGEKENLRSIVKNEETVNEEDWEKVEGLLR 181 LLE++T ++P GD +G V + QW A+ DGE EN I +++V E+ + L Sbjct: 875 LLELLTGRRPVGDFGDGVVDIAQWCKRALTDGENEN-DIICVVDKSVGMIPKEEAKHLFF 933 Query: 182 VGLFCCVQDSEKRPTMKEVETLL 250 + + C ++S +RPTM+EV +L Sbjct: 934 IAMLCVQENSVERPTMREVVQML 956 >ref|XP_004150938.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1-like [Cucumis sativus] Length = 999 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/83 (36%), Positives = 48/83 (57%) Frame = +2 Query: 2 LLEVMTRKKPTGDAFNGDVSLLQWVSMAIADGEKENLRSIVKNEETVNEEDWEKVEGLLR 181 LLE++T ++P GD +G V + QW A+ DGE EN I ++ V E+ + L Sbjct: 876 LLELLTGRRPVGDFGDGVVDIAQWCKRALTDGENEN-DIICVADKRVGMIPKEEAKHLFF 934 Query: 182 VGLFCCVQDSEKRPTMKEVETLL 250 + + C ++S +RPTM+EV +L Sbjct: 935 IAMLCVQENSVERPTMREVVQML 957