BLASTX nr result
ID: Ephedra28_contig00029400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00029400 (481 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62375.1| hypothetical protein VITISV_028920 [Vitis vinifera] 58 1e-06 >emb|CAN62375.1| hypothetical protein VITISV_028920 [Vitis vinifera] Length = 843 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = -2 Query: 213 SMFSWLFRKKKILT*DRLRRMGSKIPNCCLLCLSGVESVEHFTKECRYVKEVWQHIMPL- 37 + F+W K+LT DRL+R G ++PNCC LC S ESV+H C V+ +W ++ L Sbjct: 430 AFFAWEATWGKVLTLDRLQRRGWQLPNCCFLCGSEEESVDHLLIHCIVVRVLWDLVLALF 489 Query: 36 -THW 28 HW Sbjct: 490 GVHW 493