BLASTX nr result
ID: Ephedra28_contig00028832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00028832 (629 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23741.3| unnamed protein product [Vitis vinifera] 59 1e-06 gb|EMJ08364.1| hypothetical protein PRUPE_ppa023637mg [Prunus pe... 56 1e-05 >emb|CBI23741.3| unnamed protein product [Vitis vinifera] Length = 545 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/60 (45%), Positives = 38/60 (63%) Frame = +2 Query: 5 YATVGNWEAVAEVRRLMSRESLEKIPGTSWIEVNNVNYAFYAG*GN*RQIILFFLYFLKS 184 YA+ W+AVAEVRR+M + L K+PG SWI +NN + FY + RQ+ L L+ + S Sbjct: 471 YASSRRWDAVAEVRRMMKDKRLRKVPGCSWISINNKTHCFYTLKYSLRQVCLILLFIILS 530 >gb|EMJ08364.1| hypothetical protein PRUPE_ppa023637mg [Prunus persica] Length = 731 Score = 55.8 bits (133), Expect = 1e-05 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = +2 Query: 5 YATVGNWEAVAEVRRLMSRESLEKIPGTSWIEVNNVNYAFYAG 133 YAT GNW+ A+VR+LM +++K PG SWIEV N Y+F AG Sbjct: 572 YATAGNWQERAKVRKLMDERNVKKQPGYSWIEVKNKTYSFLAG 614