BLASTX nr result
ID: Ephedra28_contig00028442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00028442 (470 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002559317.1| ribosomal protein S12 (chloroplast) [Ephedra... 82 1e-13 ref|YP_002519977.1| ribosomal protein S12 (chloroplast) [Ephedra... 82 1e-13 dbj|BAH11205.1| ribosomal protein S12 (chloroplast) [Welwitschia... 64 2e-08 ref|YP_001876559.1| ribosomal protein S12 [Welwitschia mirabilis... 62 6e-08 gb|AGZ19238.1| ribosomal protein S12 (chloroplast) [Oryza rufipo... 60 4e-07 ref|YP_008815729.1| ribosomal protein S12 [Setaria italica] gi|5... 60 4e-07 ref|XP_004516896.1| PREDICTED: 30S ribosomal protein S12, chloro... 60 4e-07 ref|YP_001152101.1| ORF46d [Pinus koraiensis] gi|145048728|gb|AB... 60 4e-07 ref|YP_008592664.1| ribosomal protein S12 (chloroplast) [Berberi... 59 5e-07 ref|YP_008474414.1| ribosomal protein S12 (chloroplast) [Aegilop... 59 9e-07 gb|AGP51306.1| ribosomal protein S12 (chloroplast) [Triticum aes... 59 9e-07 ref|YP_008239228.1| ribosomal protein S12 (chloroplast) [Triticu... 59 9e-07 ref|YP_008239151.1| ribosomal protein S12 (chloroplast) [Secale ... 59 9e-07 ref|YP_008239072.1| ribosomal protein S12 (chloroplast) [Triticu... 59 9e-07 gb|AEQ36962.1| ribosomal protein S12 (chloroplast) [Datura stram... 59 9e-07 ref|YP_008816226.1| ribosomal protein S12 (chloroplast) [Glycine... 58 1e-06 ref|YP_008815228.1| ribosomal protein S12 (chloroplast) [Kalopan... 58 1e-06 ref|YP_008815183.1| ribosomal protein S12 (chloroplast) [Kalopan... 58 1e-06 ref|YP_008815054.1| ribosomal protein S12 (chloroplast) [Metapan... 58 1e-06 ref|YP_008815009.1| ribosomal protein S12 (chloroplast) [Metapan... 58 1e-06 >ref|YP_002559317.1| ribosomal protein S12 (chloroplast) [Ephedra equisetina] Length = 125 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 240 IHPSTNSSALRTFLKSTRTAYLFFWLSRNSNKLRKCGH 127 +HPSTNSSALRTFLKSTRTAYLFFWLSRNSNKLRKCGH Sbjct: 1 MHPSTNSSALRTFLKSTRTAYLFFWLSRNSNKLRKCGH 38 >ref|YP_002519977.1| ribosomal protein S12 (chloroplast) [Ephedra equisetina] gi|220983578|dbj|BAH11345.1| ribosomal protein S12 (chloroplast) [Ephedra equisetina] Length = 124 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYV 243 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVY+ Sbjct: 1 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYI 39 >dbj|BAH11205.1| ribosomal protein S12 (chloroplast) [Welwitschia mirabilis] Length = 125 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYV 243 MPT PQLIR ARQ KKK SR LQ+CPQRRGVCARVYV Sbjct: 1 MPTNPQLIRDARQQKKKKRGSRGLQRCPQRRGVCARVYV 39 >ref|YP_001876559.1| ribosomal protein S12 [Welwitschia mirabilis] gi|187763152|ref|YP_001876600.1| ribosomal protein S12 [Welwitschia mirabilis] gi|163311655|gb|ABY26813.1| ribosomal protein S12 [Welwitschia mirabilis] gi|163311682|gb|ABY26840.1| ribosomal protein S12 [Welwitschia mirabilis] Length = 130 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVY 240 MPT PQLIR ARQ KKK SR LQ+CPQRRGVCARVY Sbjct: 1 MPTNPQLIRDARQQKKKKRGSRGLQRCPQRRGVCARVY 38 >gb|AGZ19238.1| ribosomal protein S12 (chloroplast) [Oryza rufipogon] Length = 49 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR ARQP + S AL+ CPQRRG CARVYVRLV Sbjct: 1 MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVYVRLV 42 >ref|YP_008815729.1| ribosomal protein S12 [Setaria italica] gi|558603732|ref|YP_008815774.1| ribosomal protein S12 [Setaria italica] gi|555298066|gb|AGZ13168.1| ribosomal protein S12 [Setaria italica] gi|555298104|gb|AGZ13206.1| ribosomal protein S12 [Setaria italica] Length = 123 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR ARQP + S AL+ CPQRRG CARVYVRLV Sbjct: 1 MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVYVRLV 42 >ref|XP_004516896.1| PREDICTED: 30S ribosomal protein S12, chloroplastic-like [Cicer arietinum] gi|502181875|ref|XP_004516900.1| PREDICTED: 30S ribosomal protein S12, chloroplastic-like [Cicer arietinum] Length = 42 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR ARQP + V S AL+ CPQRRG C RVYVRLV Sbjct: 1 MPTIKQLIRNARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_001152101.1| ORF46d [Pinus koraiensis] gi|145048728|gb|ABP35347.1| ORF46d [Pinus koraiensis] Length = 46 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR ARQP + S AL+ CPQRRGVCARVYVRLV Sbjct: 1 MPTIQQLIRNARQPIENRKKSPALRGCPQRRGVCARVYVRLV 42 >ref|YP_008592664.1| ribosomal protein S12 (chloroplast) [Berberis bealei] gi|536462705|gb|AGU37070.1| ribosomal protein S12 (chloroplast) [Berberis bealei] Length = 46 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR RQP K V S AL+ CPQRRG C RVYVRLV Sbjct: 1 MPTIKQLIRNTRQPIKNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_008474414.1| ribosomal protein S12 (chloroplast) [Aegilops speltoides] gi|568245019|ref|YP_008963927.1| ribosomal protein S12 (chloroplast) [Aegilops geniculata] gi|568247017|ref|YP_008963850.1| ribosomal protein S12 (chloroplast) [Aegilops cylindrica] gi|394986515|gb|AFN42396.1| ribosomal protein S12 (chloroplast) [Aegilops speltoides] gi|554515577|gb|AGY92880.1| ribosomal protein S12 (chloroplast) [Aegilops cylindrica] gi|554515655|gb|AGY92957.1| ribosomal protein S12 (chloroplast) [Aegilops geniculata] Length = 53 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR ARQP + + AL+ CPQRRG CARVYVRLV Sbjct: 1 MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYVRLV 42 >gb|AGP51306.1| ribosomal protein S12 (chloroplast) [Triticum aestivum] Length = 133 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR ARQP + + AL+ CPQRRG CARVYVRLV Sbjct: 1 MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYVRLV 42 >ref|YP_008239228.1| ribosomal protein S12 (chloroplast) [Triticum urartu] gi|521301453|gb|AGP51250.1| ribosomal protein S12 (chloroplast) [Triticum urartu] Length = 123 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR ARQP + + AL+ CPQRRG CARVYVRLV Sbjct: 1 MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYVRLV 42 >ref|YP_008239151.1| ribosomal protein S12 (chloroplast) [Secale cereale] gi|521301292|gb|AGP51091.1| ribosomal protein S12 (chloroplast) [Secale cereale] Length = 131 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR ARQP + + AL+ CPQRRG CARVYVRLV Sbjct: 1 MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYVRLV 42 >ref|YP_008239072.1| ribosomal protein S12 (chloroplast) [Triticum monococcum] gi|533310128|ref|YP_008474279.1| ribosomal protein S12 (chloroplast) [Aegilops tauschii] gi|384406875|gb|AFH89532.1| ribosomal protein S12 (chloroplast) [Aegilops tauschii] gi|521300975|gb|AGP50778.1| ribosomal protein S12 (chloroplast) [Hordeum vulgare subsp. vulgare] gi|521301168|gb|AGP50969.1| ribosomal protein S12 (chloroplast) [Hordeum vulgare subsp. spontaneum] gi|521301213|gb|AGP51013.1| ribosomal protein S12 (chloroplast) [Triticum monococcum] Length = 132 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR ARQP + + AL+ CPQRRG CARVYVRLV Sbjct: 1 MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYVRLV 42 >gb|AEQ36962.1| ribosomal protein S12 (chloroplast) [Datura stramonium] Length = 122 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/55 (60%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV*IR-KN*NVLPRR 288 MPT+ QLIR RQP + V S AL+ CPQRRG C RVYVRLV I KN N R+ Sbjct: 1 MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVTITPKNPNSALRK 55 >ref|YP_008816226.1| ribosomal protein S12 (chloroplast) [Glycine soja] gi|558604199|ref|YP_008816270.1| ribosomal protein S12 (chloroplast) [Glycine soja] gi|557469752|gb|AHA04005.1| ribosomal protein S12 (chloroplast) [Glycine soja] gi|557469791|gb|AHA04044.1| ribosomal protein S12 (chloroplast) [Glycine soja] Length = 127 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR RQP + V S AL+ CPQRRG C RVYVRLV Sbjct: 1 MPTMKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_008815228.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] gi|458599672|gb|AGG39364.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] Length = 142 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR RQP + V S AL+ CPQRRG C RVYVRLV Sbjct: 1 MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_008815183.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] gi|458599659|gb|AGG39351.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] Length = 143 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR RQP + V S AL+ CPQRRG C RVYVRLV Sbjct: 1 MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_008815054.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] gi|458599431|gb|AGG39190.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] Length = 161 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR RQP + V S AL+ CPQRRG C RVYVRLV Sbjct: 1 MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_008815009.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] gi|458599418|gb|AGG39177.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] Length = 165 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +1 Query: 127 MPTLPQLIRIARQPKKKVGSSRALQKCPQRRGVCARVYVRLV 252 MPT+ QLIR RQP + V S AL+ CPQRRG C RVYVRLV Sbjct: 1 MPTIKQLIRNTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42