BLASTX nr result
ID: Ephedra28_contig00027675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00027675 (498 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY13086.1| Tetratricopeptide repeat (TPR)-like superfamily p... 58 2e-06 >gb|EOY13086.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 534 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 4/88 (4%) Frame = +1 Query: 1 QKGISPHARIYTVMVHGLFHKGMYEEAIVYYKEMVKKGLYVKARTLLYVRAIEGKLCVKV 180 + G+ P R YT+M+HGL+ KG E+A+ Y+ EM KG+ + RT + V A++ KL + Sbjct: 447 KSGLGPDRRSYTIMIHGLYDKGSIEDALSYFNEMTSKGMVPEPRTEILVNAMKDKLKEQE 506 Query: 181 NQK--MLPQRSIK--EPRSEFREKYLEG 252 +K P ++ K PRS+ R++ G Sbjct: 507 GEKERKEPGKNGKSLRPRSKRRKEKRTG 534