BLASTX nr result
ID: Ephedra28_contig00026271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00026271 (495 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002965861.1| hypothetical protein SELMODRAFT_406960 [Sela... 59 7e-07 >ref|XP_002965861.1| hypothetical protein SELMODRAFT_406960 [Selaginella moellendorffii] gi|302802708|ref|XP_002983108.1| hypothetical protein SELMODRAFT_422361 [Selaginella moellendorffii] gi|300149261|gb|EFJ15917.1| hypothetical protein SELMODRAFT_422361 [Selaginella moellendorffii] gi|300166675|gb|EFJ33281.1| hypothetical protein SELMODRAFT_406960 [Selaginella moellendorffii] Length = 103 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +3 Query: 249 PDAVTGVWIPQEYEGLVRIDLSSSASTEYETVRHRSVLTASMDERAWWNSMEDVPDR 419 PD VTG WIP+ +EG +ID + E R RSV TAS+++R WW+S+ED+PDR Sbjct: 42 PDPVTGTWIPEGHEG--QID-----TVELREERLRSVPTASLEDRGWWSSLEDLPDR 91