BLASTX nr result
ID: Ephedra28_contig00025573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00025573 (719 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304419.2| hypothetical protein POPTR_0003s11020g [Popu... 57 8e-06 >ref|XP_002304419.2| hypothetical protein POPTR_0003s11020g [Populus trichocarpa] gi|550342940|gb|EEE79398.2| hypothetical protein POPTR_0003s11020g [Populus trichocarpa] Length = 753 Score = 56.6 bits (135), Expect = 8e-06 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 5/65 (7%) Frame = -2 Query: 181 GSLDYAQAILARLNQFLLPRGKALQRVAYYFKEAILAL-----KSDASQQIQMPTPVDVV 17 G+ +AQ ILARLNQ L P GK L R A+YFKEA+ L S + + PTP DV+ Sbjct: 404 GNFSHAQGILARLNQQLFPTGKPLHRAAFYFKEALQLLILMNNNSVTAPPPRSPTPFDVI 463 Query: 16 EKMMA 2 KM A Sbjct: 464 FKMSA 468