BLASTX nr result
ID: Ephedra28_contig00025401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00025401 (471 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844713.1| hypothetical protein AMTR_s00016p00251370 [A... 61 2e-07 emb|CBI29291.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_002274721.1| PREDICTED: uncharacterized protein LOC100267... 59 9e-07 emb|CAN81495.1| hypothetical protein VITISV_031969 [Vitis vinifera] 59 9e-07 >ref|XP_006844713.1| hypothetical protein AMTR_s00016p00251370 [Amborella trichopoda] gi|548847184|gb|ERN06388.1| hypothetical protein AMTR_s00016p00251370 [Amborella trichopoda] Length = 354 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/40 (72%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = +3 Query: 201 NFNG-NQVLNGTVFSDPESDLTCNVSGSRKRAREETMLMT 317 NFN QV+NGTVFSDPES+LTCN+SGSRKR REE + +T Sbjct: 43 NFNYMGQVINGTVFSDPESELTCNISGSRKRTREEPVALT 82 >emb|CBI29291.3| unnamed protein product [Vitis vinifera] Length = 187 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 210 GNQVLNGTVFSDPESDLTCNVSGSRKRAREETMLMT 317 G +LNGTVFS+PESDLTCN SGSRKR RE M+ T Sbjct: 44 GQHILNGTVFSEPESDLTCNASGSRKRTRENQMVAT 79 >ref|XP_002274721.1| PREDICTED: uncharacterized protein LOC100267666 [Vitis vinifera] Length = 347 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 210 GNQVLNGTVFSDPESDLTCNVSGSRKRAREETMLMT 317 G +LNGTVFS+PESDLTCN SGSRKR RE M+ T Sbjct: 44 GQHILNGTVFSEPESDLTCNASGSRKRTRENQMVAT 79 >emb|CAN81495.1| hypothetical protein VITISV_031969 [Vitis vinifera] Length = 553 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 210 GNQVLNGTVFSDPESDLTCNVSGSRKRAREETMLMT 317 G +LNGTVFS+PESDLTCN SGSRKR RE M+ T Sbjct: 44 GQHILNGTVFSEPESDLTCNASGSRKRTRENQMVAT 79