BLASTX nr result
ID: Ephedra28_contig00025126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00025126 (495 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002888167.1| hypothetical protein ARALYDRAFT_893564 [Arab... 67 2e-09 emb|CAM96541.1| 17.0 kDa heat-shock protein [Aegilops kotschyi] 66 4e-09 prf||1107298A protein,small heat shock 65 7e-09 ref|NP_001235177.1| 18.5 kDa class I heat shock protein [Glycine... 65 7e-09 sp|P04794.1|HSP14_SOYBN RecName: Full=17.5 kDa class I heat shoc... 65 7e-09 ref|XP_002891756.1| 17.6 kDa class I small heat shock protein [A... 65 7e-09 ref|NP_001240953.1| uncharacterized protein LOC100812935 [Glycin... 65 7e-09 ref|NP_001236198.1| uncharacterized protein LOC100305750 [Glycin... 65 7e-09 ref|NP_172220.1| class I heat shock protein [Arabidopsis thalian... 65 9e-09 ref|NP_176195.1| HSP20-like chaperone [Arabidopsis thaliana] gi|... 65 9e-09 ref|XP_002312898.2| hypothetical protein POPTR_0009s15020g [Popu... 65 9e-09 gb|EOY33872.1| HSP20-like chaperones superfamily protein [Theobr... 65 9e-09 ref|XP_004505087.1| PREDICTED: 18.5 kDa class I heat shock prote... 65 9e-09 ref|XP_004505085.1| PREDICTED: 18.5 kDa class I heat shock prote... 65 9e-09 ref|XP_004505083.1| PREDICTED: 18.5 kDa class I heat shock prote... 65 9e-09 ref|XP_006302970.1| hypothetical protein CARUB_v10021109mg [Caps... 65 9e-09 gb|AAR01523.1| cytosolic class I small heat shock protein 3B, pa... 65 9e-09 gb|AAR01521.1| cytosolic class I small heat shock protein 3A, pa... 65 9e-09 gb|AAR01527.1| cytosolic class I small heat shock protein 3C, pa... 65 9e-09 gb|ADK36668.1| cytosolic class I small heat shock protein 3B [Ni... 65 9e-09 >ref|XP_002888167.1| hypothetical protein ARALYDRAFT_893564 [Arabidopsis lyrata subsp. lyrata] gi|297334008|gb|EFH64426.1| hypothetical protein ARALYDRAFT_893564 [Arabidopsis lyrata subsp. lyrata] Length = 156 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -2 Query: 113 SECKVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 + +VDWKETE+AHVFKADLPG+KKEEVKV+IEDD V Sbjct: 46 ANARVDWKETEEAHVFKADLPGMKKEEVKVEIEDDTV 82 >emb|CAM96541.1| 17.0 kDa heat-shock protein [Aegilops kotschyi] Length = 151 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -2 Query: 113 SECKVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 + +VDWKET +AHVFKADLPG+KKEEVKV++EDDNV Sbjct: 42 ANARVDWKETPEAHVFKADLPGVKKEEVKVEVEDDNV 78 >prf||1107298A protein,small heat shock Length = 154 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKAD+PGLKKEEVKVQIEDD V Sbjct: 48 RVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRV 81 >ref|NP_001235177.1| 18.5 kDa class I heat shock protein [Glycine max] gi|123544|sp|P05478.1|HSP16_SOYBN RecName: Full=18.5 kDa class I heat shock protein; AltName: Full=HSP 18.5 gi|18654|emb|CAA30154.1| unnamed protein product [Glycine max] gi|255626097|gb|ACU13393.1| unknown [Glycine max] Length = 161 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKAD+PGLKKEEVKVQIEDD V Sbjct: 55 RVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKV 88 >sp|P04794.1|HSP14_SOYBN RecName: Full=17.5 kDa class I heat shock protein; AltName: Full=HSP 17.5-E gi|169987|gb|AAA33975.1| small heat shock protein [Glycine max] Length = 154 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKAD+PGLKKEEVKVQIEDD V Sbjct: 48 RVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRV 81 >ref|XP_002891756.1| 17.6 kDa class I small heat shock protein [Arabidopsis lyrata subsp. lyrata] gi|297337598|gb|EFH68015.1| 17.6 kDa class I small heat shock protein [Arabidopsis lyrata subsp. lyrata] Length = 157 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 113 SECKVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 + KVDWKET +AHVFKADLPGLKKEEVKV++ED N+ Sbjct: 48 TNAKVDWKETPEAHVFKADLPGLKKEEVKVEVEDGNI 84 >ref|NP_001240953.1| uncharacterized protein LOC100812935 [Glycine max] gi|255627179|gb|ACU13934.1| unknown [Glycine max] Length = 154 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKAD+PGLKKEEVKVQIEDD V Sbjct: 48 RVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRV 81 >ref|NP_001236198.1| uncharacterized protein LOC100305750 [Glycine max] gi|255626519|gb|ACU13604.1| unknown [Glycine max] Length = 154 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKAD+PGLKKEEVKVQIEDD V Sbjct: 48 RVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRV 81 >ref|NP_172220.1| class I heat shock protein [Arabidopsis thaliana] gi|75311415|sp|Q9LNW0.1|HS178_ARATH RecName: Full=17.8 kDa class I heat shock protein; AltName: Full=17.8 kDa heat shock protein; Short=AtHsp17.8 gi|8778561|gb|AAF79569.1|AC022464_27 F22G5.25 [Arabidopsis thaliana] gi|21555637|gb|AAM63903.1| heat shock protein, putative [Arabidopsis thaliana] gi|26452709|dbj|BAC43437.1| putative heat shock protein [Arabidopsis thaliana] gi|28973039|gb|AAO63844.1| putative heat shock protein [Arabidopsis thaliana] gi|332189999|gb|AEE28120.1| class I heat shock protein [Arabidopsis thaliana] Length = 157 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -2 Query: 113 SECKVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 + +VDWKET +AHVFKADLPG+KKEEVKV+IEDD+V Sbjct: 46 TNARVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSV 82 >ref|NP_176195.1| HSP20-like chaperone [Arabidopsis thaliana] gi|75315310|sp|Q9XIE3.1|HS17A_ARATH RecName: Full=17.6 kDa class I heat shock protein 1; AltName: Full=17.6 kDa heat shock protein 1; Short=AtHsp17.6A gi|5080819|gb|AAD39328.1|AC007258_17 Putative Heat shock hsp20 protein [Arabidopsis thaliana] gi|51968438|dbj|BAD42911.1| unknown protein [Arabidopsis thaliana] gi|51968672|dbj|BAD43028.1| unknown protein [Arabidopsis thaliana] gi|88900414|gb|ABD57519.1| At1g59860 [Arabidopsis thaliana] gi|332195508|gb|AEE33629.1| HSP20-like chaperone [Arabidopsis thaliana] Length = 155 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -2 Query: 113 SECKVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 + +VDWKET +AHVFKADLPG+KKEEVKV+IEDD+V Sbjct: 44 ANARVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSV 80 >ref|XP_002312898.2| hypothetical protein POPTR_0009s15020g [Populus trichocarpa] gi|550331760|gb|EEE86853.2| hypothetical protein POPTR_0009s15020g [Populus trichocarpa] Length = 159 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 116 SSECKVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 S ++DWKET +AHVFKADLPGLKKEEVKV+IEDD V Sbjct: 49 SVNTRIDWKETPEAHVFKADLPGLKKEEVKVEIEDDRV 86 >gb|EOY33872.1| HSP20-like chaperones superfamily protein [Theobroma cacao] Length = 150 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKADLPGLKKEEVKV+IEDD V Sbjct: 44 RVDWKETPEAHVFKADLPGLKKEEVKVEIEDDRV 77 >ref|XP_004505087.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum] Length = 160 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKADLPGLKKEEVKV+IEDD V Sbjct: 54 RVDWKETPEAHVFKADLPGLKKEEVKVEIEDDRV 87 >ref|XP_004505085.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum] Length = 160 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKADLPGLKKEEVKV+IEDD V Sbjct: 54 RVDWKETPEAHVFKADLPGLKKEEVKVEIEDDRV 87 >ref|XP_004505083.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum] Length = 160 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKADLPGLKKEEVKV+IEDD V Sbjct: 54 RVDWKETPEAHVFKADLPGLKKEEVKVEIEDDRV 87 >ref|XP_006302970.1| hypothetical protein CARUB_v10021109mg [Capsella rubella] gi|482571680|gb|EOA35868.1| hypothetical protein CARUB_v10021109mg [Capsella rubella] Length = 148 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -2 Query: 113 SECKVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 + +VDWKET +AHVFKADLPG+KKEEVKV+IEDD+V Sbjct: 38 ANARVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSV 74 >gb|AAR01523.1| cytosolic class I small heat shock protein 3B, partial [Nicotiana tabacum] gi|37704439|gb|AAR01524.1| cytosolic class I small heat shock protein 3B, partial [Nicotiana tabacum] gi|37704441|gb|AAR01525.1| cytosolic class I small heat shock protein 3B, partial [Nicotiana tabacum] gi|37704443|gb|AAR01526.1| cytosolic class I small heat shock protein 3B, partial [Nicotiana tabacum] Length = 124 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKADLPGLKKEEVKV+IEDD V Sbjct: 18 RVDWKETPEAHVFKADLPGLKKEEVKVEIEDDRV 51 >gb|AAR01521.1| cytosolic class I small heat shock protein 3A, partial [Nicotiana tabacum] gi|37704435|gb|AAR01522.1| cytosolic class I small heat shock protein 3A, partial [Nicotiana tabacum] gi|37704447|gb|AAR01528.1| cytosolic class I small heat shock protein 3D, partial [Nicotiana tabacum] Length = 124 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKADLPGLKKEEVKV+IEDD V Sbjct: 18 RVDWKETPEAHVFKADLPGLKKEEVKVEIEDDRV 51 >gb|AAR01527.1| cytosolic class I small heat shock protein 3C, partial [Nicotiana tabacum] Length = 124 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKADLPGLKKEEVKV+IEDD V Sbjct: 18 RVDWKETPEAHVFKADLPGLKKEEVKVEIEDDRV 51 >gb|ADK36668.1| cytosolic class I small heat shock protein 3B [Nicotiana tabacum] Length = 153 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 104 KVDWKETEDAHVFKADLPGLKKEEVKVQIEDDNV 3 +VDWKET +AHVFKADLPGLKKEEVKV+IEDD V Sbjct: 47 RVDWKETPEAHVFKADLPGLKKEEVKVEIEDDRV 80