BLASTX nr result
ID: Ephedra28_contig00025119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00025119 (843 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849811.1| hypothetical protein AMTR_s00176p00064210 [A... 59 2e-06 ref|XP_006386378.1| hypothetical protein POPTR_0002s08690g [Popu... 59 3e-06 ref|XP_002302251.2| hypothetical protein POPTR_0002s08690g [Popu... 59 3e-06 ref|XP_004160827.1| PREDICTED: LOW QUALITY PROTEIN: DIS3-like ex... 57 8e-06 ref|XP_004140974.1| PREDICTED: DIS3-like exonuclease 2-like [Cuc... 57 8e-06 >ref|XP_006849811.1| hypothetical protein AMTR_s00176p00064210 [Amborella trichopoda] gi|548853388|gb|ERN11392.1| hypothetical protein AMTR_s00176p00064210 [Amborella trichopoda] Length = 1165 Score = 58.9 bits (141), Expect = 2e-06 Identities = 38/85 (44%), Positives = 51/85 (60%), Gaps = 5/85 (5%) Frame = +3 Query: 60 KSEDCSESLQNLEVE----TREDFLGNMLDGDLEHDNIHP-YSIEPAVFPLILGPLSTVP 224 K+ D SE EV T E G+ L + + + +++PAVFPL L LSTVP Sbjct: 1080 KTSDLSEPTSEQEVRDENITHEATPGSCLVVNPYNKQVRQNQAVDPAVFPLTLQYLSTVP 1139 Query: 225 VSLYAVGGEKEPPDVSVRLFASSYL 299 VS+ AVGGE+ D++VRL+ASSYL Sbjct: 1140 VSVNAVGGERSRMDIAVRLYASSYL 1164 >ref|XP_006386378.1| hypothetical protein POPTR_0002s08690g [Populus trichocarpa] gi|550344578|gb|ERP64175.1| hypothetical protein POPTR_0002s08690g [Populus trichocarpa] Length = 1099 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +3 Query: 153 DNIHPYSIEPAVFPLILGPLSTVPVSLYAVGGEKEPPDVSVRLFASSY 296 D I I+P+VFPL + LST+PV+L+A+GG+ PPD+ VRLF SSY Sbjct: 1050 DAILKSEIDPSVFPLTVRLLSTIPVALHAIGGDDGPPDIGVRLFMSSY 1097 >ref|XP_002302251.2| hypothetical protein POPTR_0002s08690g [Populus trichocarpa] gi|550344577|gb|EEE81524.2| hypothetical protein POPTR_0002s08690g [Populus trichocarpa] Length = 1083 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +3 Query: 153 DNIHPYSIEPAVFPLILGPLSTVPVSLYAVGGEKEPPDVSVRLFASSY 296 D I I+P+VFPL + LST+PV+L+A+GG+ PPD+ VRLF SSY Sbjct: 1034 DAILKSEIDPSVFPLTVRLLSTIPVALHAIGGDDGPPDIGVRLFMSSY 1081 >ref|XP_004160827.1| PREDICTED: LOW QUALITY PROTEIN: DIS3-like exonuclease 2-like [Cucumis sativus] Length = 1159 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 174 IEPAVFPLILGPLSTVPVSLYAVGGEKEPPDVSVRLFASSYLR 302 ++PA+FPL + LST+PV+L+AVGG+ P D+ VRL+ SSYLR Sbjct: 1117 VDPAIFPLTVRLLSTIPVALHAVGGDDGPIDIGVRLYMSSYLR 1159 >ref|XP_004140974.1| PREDICTED: DIS3-like exonuclease 2-like [Cucumis sativus] Length = 1125 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 174 IEPAVFPLILGPLSTVPVSLYAVGGEKEPPDVSVRLFASSYLR 302 ++PA+FPL + LST+PV+L+AVGG+ P D+ VRL+ SSYLR Sbjct: 1083 VDPAIFPLTVRLLSTIPVALHAVGGDDGPIDIGVRLYMSSYLR 1125