BLASTX nr result
ID: Ephedra28_contig00025035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00025035 (467 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518894.1| PREDICTED: phospholipase A1-Igamma1, chlorop... 58 1e-06 ref|XP_004168244.1| PREDICTED: phospholipase A1-Igamma2, chlorop... 57 3e-06 ref|XP_004146954.1| PREDICTED: phospholipase A1-Igamma2, chlorop... 57 3e-06 >ref|XP_003518894.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine max] Length = 513 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/65 (46%), Positives = 39/65 (60%) Frame = +1 Query: 1 QVVRVVNAKDVVPKVPGMVINENTKPCFVASWLQWLPWAYFHAGREIRLPPTPKPYNNNT 180 +V+RVVN DVVPK PG+V NE+ P V + LPW+Y+H G E+ L P+ N Sbjct: 356 KVLRVVNVHDVVPKAPGVVFNEHL-PAAVMKVAEGLPWSYWHVGVELALDHKKSPFLNPN 414 Query: 181 AAKVS 195 A VS Sbjct: 415 ADAVS 419 >ref|XP_004168244.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis sativus] Length = 508 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/56 (44%), Positives = 34/56 (60%) Frame = +1 Query: 1 QVVRVVNAKDVVPKVPGMVINENTKPCFVASWLQWLPWAYFHAGREIRLPPTPKPY 168 +V+RVVN D+VPK PG+ +NE P ++ WLPW+Y H G E+ L PY Sbjct: 352 KVLRVVNIHDIVPKSPGLFLNEKLPP-WLLKMTTWLPWSYVHVGVELELDHLESPY 406 >ref|XP_004146954.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Cucumis sativus] Length = 508 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/56 (44%), Positives = 34/56 (60%) Frame = +1 Query: 1 QVVRVVNAKDVVPKVPGMVINENTKPCFVASWLQWLPWAYFHAGREIRLPPTPKPY 168 +V+RVVN D+VPK PG+ +NE P ++ WLPW+Y H G E+ L PY Sbjct: 352 KVLRVVNIHDIVPKSPGLFLNEKLPP-WLLKMTTWLPWSYVHVGVELELDHLESPY 406