BLASTX nr result
ID: Ephedra28_contig00024970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00024970 (413 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422261.1| hypothetical protein CICLE_v10004323mg [Citr... 65 7e-09 gb|ESW23563.1| hypothetical protein PHAVU_004G057900g [Phaseolus... 65 9e-09 gb|EPS63181.1| hypothetical protein M569_11602, partial [Genlise... 65 1e-08 ref|XP_006359236.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006300415.1| hypothetical protein CARUB_v10021690mg [Caps... 64 2e-08 ref|XP_002316152.1| pentatricopeptide repeat-containing family p... 64 2e-08 gb|EMJ14480.1| hypothetical protein PRUPE_ppa027212mg, partial [... 64 2e-08 ref|XP_003555011.2| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_004138818.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|NP_178067.1| pentatricopeptide repeat-containing protein [Ar... 64 3e-08 ref|XP_002887788.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] g... 64 3e-08 ref|XP_006389884.1| hypothetical protein EUTSA_v10018121mg [Eutr... 63 4e-08 gb|EOY20099.1| Pentatricopeptide repeat (PPR) superfamily protei... 63 4e-08 ref|XP_004245808.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_004306550.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 ref|XP_004504664.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 gb|EXB51258.1| hypothetical protein L484_019251 [Morus notabilis] 62 8e-08 ref|XP_006652805.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 tpg|DAA36062.1| TPA: hypothetical protein ZEAMMB73_917988 [Zea m... 62 8e-08 ref|XP_002448513.1| hypothetical protein SORBIDRAFT_06g028250 [S... 62 8e-08 >ref|XP_006422261.1| hypothetical protein CICLE_v10004323mg [Citrus clementina] gi|568881878|ref|XP_006493776.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Citrus sinensis] gi|557524134|gb|ESR35501.1| hypothetical protein CICLE_v10004323mg [Citrus clementina] Length = 827 Score = 65.5 bits (158), Expect = 7e-09 Identities = 25/38 (65%), Positives = 38/38 (100%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP+++DILMH++N++FPCS+P+++S++PP Sbjct: 782 IVQQFLLNEIPSRADILMHKMNILFPCSAPELRSLSPP 819 >gb|ESW23563.1| hypothetical protein PHAVU_004G057900g [Phaseolus vulgaris] Length = 755 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/38 (71%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP++SDILMHRLN++FP S+P+++S++PP Sbjct: 709 IVQQFLLNEIPSRSDILMHRLNILFPSSAPEVRSLSPP 746 >gb|EPS63181.1| hypothetical protein M569_11602, partial [Genlisea aurea] Length = 740 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/38 (68%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 +VQQFLLNEIP++S+ILMH+LN+ FPCS+P+++S+APP Sbjct: 694 MVQQFLLNEIPSRSEILMHKLNVEFPCSAPEVRSLAPP 731 >ref|XP_006359236.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Solanum tuberosum] Length = 794 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/38 (71%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP++SDILMH+LN++FP S+P+I+S++PP Sbjct: 748 IVQQFLLNEIPSRSDILMHKLNILFPTSAPEIRSLSPP 785 >ref|XP_006300415.1| hypothetical protein CARUB_v10021690mg [Capsella rubella] gi|482569125|gb|EOA33313.1| hypothetical protein CARUB_v10021690mg [Capsella rubella] Length = 836 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/38 (71%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP++SDILMH+LN+MFP S+P+++S++PP Sbjct: 790 IVQQFLLNEIPSRSDILMHKLNVMFPSSAPELRSMSPP 827 >ref|XP_002316152.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222865192|gb|EEF02323.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 785 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/38 (71%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP+++DILMHRLN++FP S+P+I+S++PP Sbjct: 739 IVQQFLLNEIPSRADILMHRLNILFPTSAPEIRSLSPP 776 >gb|EMJ14480.1| hypothetical protein PRUPE_ppa027212mg, partial [Prunus persica] Length = 747 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP++SDILMH+LN +FP S+P+++S+APP Sbjct: 702 IVQQFLLNEIPSRSDILMHKLNTLFPSSAPELRSLAPP 739 >ref|XP_003555011.2| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Glycine max] Length = 818 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/38 (68%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP++SDILMH+LN++FP S+P+++S++PP Sbjct: 772 IVQQFLLNEIPSRSDILMHKLNILFPSSAPELRSLSPP 809 >ref|XP_004138818.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Cucumis sativus] gi|449490234|ref|XP_004158545.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Cucumis sativus] Length = 823 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP++SDILMH+LN +FP S+P+I+S++PP Sbjct: 777 IVQQFLLNEIPSRSDILMHKLNTLFPSSAPEIRSLSPP 814 >ref|NP_178067.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200795|sp|Q9SAK0.1|PP132_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g79490, mitochondrial; AltName: Full=Protein EMBRYO DEFECTIVE 2217; Flags: Precursor gi|4835759|gb|AAD30226.1|AC007202_8 T8K14.9 [Arabidopsis thaliana] gi|332198129|gb|AEE36250.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 836 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/38 (68%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP++SDILMH++N+MFP S+P+++S++PP Sbjct: 790 IVQQFLLNEIPSRSDILMHKMNVMFPSSAPELRSMSPP 827 >ref|XP_002887788.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] gi|297333629|gb|EFH64047.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] Length = 832 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/38 (68%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP++SDILMH++N+MFP S+P+++S++PP Sbjct: 786 IVQQFLLNEIPSRSDILMHKMNVMFPSSAPELRSMSPP 823 >ref|XP_006389884.1| hypothetical protein EUTSA_v10018121mg [Eutrema salsugineum] gi|557086318|gb|ESQ27170.1| hypothetical protein EUTSA_v10018121mg [Eutrema salsugineum] Length = 836 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/38 (68%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP+++DILMH+LN+MFP S+P+++S++PP Sbjct: 790 IVQQFLLNEIPSRADILMHKLNVMFPSSAPELRSMSPP 827 >gb|EOY20099.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 820 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/38 (68%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP+++DILMH+LN++FP S+P+I+S++PP Sbjct: 774 IVQQFLLNEIPSRADILMHKLNILFPSSAPEIRSLSPP 811 >ref|XP_004245808.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Solanum lycopersicum] Length = 794 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/38 (68%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP+++DILMH+LN++FP S+P+I+S++PP Sbjct: 748 IVQQFLLNEIPSRADILMHKLNILFPTSAPEIRSLSPP 785 >ref|XP_004306550.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 844 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/38 (68%), Positives = 36/38 (94%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP++SDILMH+LN +FP S+P+++S++PP Sbjct: 798 IVQQFLLNEIPSRSDILMHKLNTLFPSSAPELRSLSPP 835 >ref|XP_004504664.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Cicer arietinum] Length = 824 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/38 (68%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP+++DILMH+LN++FP S+P+I+S++PP Sbjct: 778 IVQQFLLNEIPSRADILMHKLNILFPNSAPEIRSLSPP 815 >gb|EXB51258.1| hypothetical protein L484_019251 [Morus notabilis] Length = 834 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/38 (63%), Positives = 37/38 (97%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP+K+++LMH+LN++FP S+P+++S++PP Sbjct: 788 IVQQFLLNEIPSKAEVLMHKLNILFPSSAPEVRSLSPP 825 >ref|XP_006652805.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Oryza brachyantha] Length = 533 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/38 (68%), Positives = 36/38 (94%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP+K+D+LMHRLN+MFP S+P+++S++ P Sbjct: 489 IVQQFLLNEIPSKADVLMHRLNVMFPSSAPEVRSLSIP 526 >tpg|DAA36062.1| TPA: hypothetical protein ZEAMMB73_917988 [Zea mays] gi|414585492|tpg|DAA36063.1| TPA: hypothetical protein ZEAMMB73_917988 [Zea mays] Length = 787 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/38 (68%), Positives = 36/38 (94%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP+K+D+LMHRLN+MFP S+P+++S++ P Sbjct: 743 IVQQFLLNEIPSKADVLMHRLNVMFPSSAPEVRSLSIP 780 >ref|XP_002448513.1| hypothetical protein SORBIDRAFT_06g028250 [Sorghum bicolor] gi|241939696|gb|EES12841.1| hypothetical protein SORBIDRAFT_06g028250 [Sorghum bicolor] Length = 718 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/38 (68%), Positives = 36/38 (94%) Frame = -3 Query: 411 IVQQFLLNEIPTKSDILMHRLNMMFPCSSPDIQSIAPP 298 IVQQFLLNEIP+K+D+LMHRLN+MFP S+P+++S++ P Sbjct: 674 IVQQFLLNEIPSKADVLMHRLNVMFPSSAPEVRSLSIP 711