BLASTX nr result
ID: Ephedra28_contig00024437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00024437 (704 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW14815.1| hypothetical protein PHAVU_007G019700g [Phaseolus... 57 4e-06 >gb|ESW14815.1| hypothetical protein PHAVU_007G019700g [Phaseolus vulgaris] Length = 267 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/98 (30%), Positives = 52/98 (53%), Gaps = 1/98 (1%) Frame = +1 Query: 367 FSVVLPKTAAGANYLLYVPKNVRVLLGSGHDVT-IRVASKEWKVRYMTRKQGIYDTGAFS 543 F V + + A Y L VP ++R L+G + + + WKV+ + + FS Sbjct: 170 FFTVFIRPSHTATYRLSVP-DLRGLIGEKERYAMLELGERGWKVKLIANNSSYFSHHRFS 228 Query: 544 TGWRDIVKECKLKKGDTCLFRLLDFQEWVFLLKIFKSH 657 TGW ++E +L+ GD C+F L+ ++ VF + +FK+H Sbjct: 229 TGWYLFLRETELQSGDVCVFELISKEDCVFKVHVFKNH 266