BLASTX nr result
ID: Ephedra28_contig00024241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00024241 (734 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW07905.1| hypothetical protein 0_14083_01, partial [Pinus r... 65 3e-08 >gb|AEW07905.1| hypothetical protein 0_14083_01, partial [Pinus radiata] gi|383132654|gb|AFG47217.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132656|gb|AFG47218.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132658|gb|AFG47219.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132660|gb|AFG47220.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132662|gb|AFG47221.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132664|gb|AFG47222.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132666|gb|AFG47223.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132668|gb|AFG47224.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132670|gb|AFG47225.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132672|gb|AFG47226.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132674|gb|AFG47227.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132676|gb|AFG47228.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132678|gb|AFG47229.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132680|gb|AFG47230.1| hypothetical protein 0_14083_01, partial [Pinus taeda] Length = 146 Score = 64.7 bits (156), Expect = 3e-08 Identities = 42/117 (35%), Positives = 63/117 (53%), Gaps = 1/117 (0%) Frame = -1 Query: 437 DGSTLYADNLVLSSRSXXXXXXXXXXXXXKN-TRKVTIDDVKTETVLDFLFFLYEHKLRE 261 DGS L+A L+L +RS + TR+V I +V E++ FL FLY +L Sbjct: 22 DGSQLFAHGLILVNRSEVFRKMLEEVDLKEKETREVVIQEVGGESLKTFLKFLYTAQLNS 81 Query: 260 VPSGEGRKELLQLAHRFDVKELVHFLDGCIVHELVKTPSDLELLKMGFIYHLPKTKE 90 +EL++LAH + VK L+ LD I E+V + +E+LKM ++Y L T+E Sbjct: 82 EEMHAKYRELVKLAHFYQVKLLLMKLDNFISSEIVSKNACIEILKMAYLYDLETTRE 138