BLASTX nr result
ID: Ephedra28_contig00023877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00023877 (521 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006575994.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-06 >ref|XP_006575994.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like [Glycine max] Length = 443 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/42 (50%), Positives = 35/42 (83%) Frame = -2 Query: 130 HGRSVHNHLVRNGFPLNLNVGKALLSMYAKCGLMEEACQVFD 5 HG+ VH +++R+GFP +++G AL++MYAKCG +++A +VFD Sbjct: 288 HGKQVHGYILRHGFPSEVSLGNALVTMYAKCGSLDKALRVFD 329