BLASTX nr result
ID: Ephedra28_contig00023194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00023194 (330 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836439.1| hypothetical protein AMTR_s00092p00167170 [A... 65 7e-09 >ref|XP_006836439.1| hypothetical protein AMTR_s00092p00167170 [Amborella trichopoda] gi|548838957|gb|ERM99292.1| hypothetical protein AMTR_s00092p00167170 [Amborella trichopoda] Length = 416 Score = 65.5 bits (158), Expect = 7e-09 Identities = 37/83 (44%), Positives = 52/83 (62%), Gaps = 1/83 (1%) Frame = -2 Query: 293 FSPLPLKLKTRKRTEMEGGGVSC-LIPGLPNDVALNCLVRVCITSHTAMLLVSKGWRDTL 117 FSP P + +E EGGG LIPGLP+D+ALNCL+R+ + +H V K WR L Sbjct: 32 FSPSP----SSSLSESEGGGEFLPLIPGLPDDIALNCLLRIPVHAHPLCRPVCKRWRSLL 87 Query: 116 LDRNSVLYMLRSQLGLIQPAAFL 48 L++ + + LR QLGL++P F+ Sbjct: 88 LNKET-FFTLRRQLGLVEPWLFV 109