BLASTX nr result
ID: Ephedra28_contig00023112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00023112 (642 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433530.1| hypothetical protein CICLE_v10003523mg [Citr... 57 5e-06 emb|CAC84497.1| hypothetical protein [Pinus pinaster] 56 8e-06 >ref|XP_006433530.1| hypothetical protein CICLE_v10003523mg [Citrus clementina] gi|557535652|gb|ESR46770.1| hypothetical protein CICLE_v10003523mg [Citrus clementina] Length = 356 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = -1 Query: 642 GGQATTFKGHVLQFPYGVFDKHYESLLQADERLNKLTRKPLCD-KTPYFY 496 GGQA F+ H L+FP GV D+H+E LLQ D RL +L+RKP +PYF+ Sbjct: 233 GGQAPVFRKHYLKFPPGVLDRHFEKLLQCDSRLFELSRKPFPTLDSPYFH 282 >emb|CAC84497.1| hypothetical protein [Pinus pinaster] Length = 197 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = -1 Query: 642 GGQATTFKGHVLQFPYGVFDKHYESLLQADERLNKLTRKP-LCDKTPYFYSRVGGAGFHQ 466 GGQAT + H LQ P+G+ ++HYE L+Q D RLN L++K L + +P F S+ A F Sbjct: 120 GGQATICRRHFLQCPHGLLNRHYEKLIQCDPRLNLLSKKGFLSEASPLFDSK--SAVFQD 177 Query: 465 LQQQEPY 445 L +Q Y Sbjct: 178 LDEQSSY 184