BLASTX nr result
ID: Ephedra28_contig00022617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00022617 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843677.1| hypothetical protein AMTR_s00007p00193000 [A... 82 6e-14 gb|ABR18143.1| unknown [Picea sitchensis] 73 4e-11 ref|XP_002983713.1| hypothetical protein SELMODRAFT_49296 [Selag... 70 3e-10 ref|XP_001751523.1| single myb histone protein [Physcomitrella p... 69 5e-10 ref|XP_001774405.1| single myb histone protein [Physcomitrella p... 69 5e-10 gb|AFG51645.1| hypothetical protein UMN_3361_01, partial [Pinus ... 69 6e-10 gb|AEW09309.1| hypothetical protein UMN_3361_01, partial [Pinus ... 69 6e-10 ref|XP_002972715.1| hypothetical protein SELMODRAFT_413266 [Sela... 69 6e-10 ref|XP_002988079.1| hypothetical protein SELMODRAFT_426759 [Sela... 69 6e-10 gb|ADE76468.1| unknown [Picea sitchensis] 69 6e-10 ref|XP_006352110.1| PREDICTED: telomere repeat-binding factor 1-... 67 2e-09 ref|XP_006393200.1| hypothetical protein EUTSA_v10011686mg [Eutr... 67 2e-09 ref|XP_006303249.1| hypothetical protein CARUB_v10009836mg [Caps... 67 2e-09 ref|XP_004250736.1| PREDICTED: telomere repeat-binding factor 1-... 67 2e-09 ref|XP_004250733.1| PREDICTED: telomere repeat-binding factor 1-... 67 2e-09 gb|AAF76448.1|AC015445_15 Contains similarity to DNA-binding pro... 67 2e-09 ref|XP_002894224.1| telomere repeat binding factor 1 [Arabidopsi... 67 2e-09 gb|AAL73438.1|U83624_1 telomere repeat binding factor 1 [Arabido... 67 2e-09 gb|AAM65540.1| DNA-binding protein PcMYB1, putative [Arabidopsis... 67 2e-09 ref|NP_564559.1| telomere repeat binding factor 1 [Arabidopsis t... 67 2e-09 >ref|XP_006843677.1| hypothetical protein AMTR_s00007p00193000 [Amborella trichopoda] gi|548846045|gb|ERN05352.1| hypothetical protein AMTR_s00007p00193000 [Amborella trichopoda] Length = 330 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -1 Query: 142 EARKKIVGF*RMGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDPV 2 ++ KK+ GF MGAPKQKWT+EEE+ALRAGV+KYGPGKWR ILKDPV Sbjct: 20 DSLKKVAGFLSMGAPKQKWTSEEEAALRAGVDKYGPGKWRTILKDPV 66 >gb|ABR18143.1| unknown [Picea sitchensis] Length = 298 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT+EEE+ALR GVEKYGPGKWRAIL+DP Sbjct: 1 MGAPKQKWTHEEEAALRTGVEKYGPGKWRAILRDP 35 >ref|XP_002983713.1| hypothetical protein SELMODRAFT_49296 [Selaginella moellendorffii] gi|302814722|ref|XP_002989044.1| hypothetical protein SELMODRAFT_49297 [Selaginella moellendorffii] gi|300143145|gb|EFJ09838.1| hypothetical protein SELMODRAFT_49297 [Selaginella moellendorffii] gi|300148550|gb|EFJ15209.1| hypothetical protein SELMODRAFT_49296 [Selaginella moellendorffii] Length = 61 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT EEE ALRAGVEKYGPGKWRAI +DP Sbjct: 1 MGAPKQKWTAEEECALRAGVEKYGPGKWRAIQRDP 35 >ref|XP_001751523.1| single myb histone protein [Physcomitrella patens] gi|162697504|gb|EDQ83840.1| single myb histone protein [Physcomitrella patens] Length = 443 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKD 8 MGAPKQKWT EEE+ALRAGVEKYGPGKWRAI KD Sbjct: 1 MGAPKQKWTAEEEAALRAGVEKYGPGKWRAIQKD 34 >ref|XP_001774405.1| single myb histone protein [Physcomitrella patens] gi|162674257|gb|EDQ60768.1| single myb histone protein [Physcomitrella patens] Length = 345 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKD 8 MGAPKQKWT EEE+ALRAGVEKYGPGKWRAI KD Sbjct: 1 MGAPKQKWTAEEEAALRAGVEKYGPGKWRAIQKD 34 >gb|AFG51645.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140704|gb|AFG51646.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140705|gb|AFG51647.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140706|gb|AFG51648.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140707|gb|AFG51649.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140708|gb|AFG51650.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140709|gb|AFG51651.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140710|gb|AFG51652.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140711|gb|AFG51653.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140712|gb|AFG51654.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140713|gb|AFG51655.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140714|gb|AFG51656.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140715|gb|AFG51657.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140716|gb|AFG51658.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] gi|383140717|gb|AFG51659.1| hypothetical protein UMN_3361_01, partial [Pinus taeda] Length = 83 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT+EEE ALRAGVEKYG GKW+ ILKDP Sbjct: 1 MGAPKQKWTSEEEGALRAGVEKYGAGKWQTILKDP 35 >gb|AEW09309.1| hypothetical protein UMN_3361_01, partial [Pinus lambertiana] Length = 84 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT+EEE ALRAGVEKYG GKW+ ILKDP Sbjct: 1 MGAPKQKWTSEEEGALRAGVEKYGAGKWQTILKDP 35 >ref|XP_002972715.1| hypothetical protein SELMODRAFT_413266 [Selaginella moellendorffii] gi|300159316|gb|EFJ25936.1| hypothetical protein SELMODRAFT_413266 [Selaginella moellendorffii] Length = 303 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT EEE+ALRAGVEKYG GKWRAI KDP Sbjct: 1 MGAPKQKWTPEEEAALRAGVEKYGAGKWRAIQKDP 35 >ref|XP_002988079.1| hypothetical protein SELMODRAFT_426759 [Selaginella moellendorffii] gi|300144185|gb|EFJ10871.1| hypothetical protein SELMODRAFT_426759 [Selaginella moellendorffii] Length = 303 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT EEE+ALRAGVEKYG GKWRAI KDP Sbjct: 1 MGAPKQKWTPEEEAALRAGVEKYGAGKWRAIQKDP 35 >gb|ADE76468.1| unknown [Picea sitchensis] Length = 289 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT+EEE ALRAGVEKYG GKW+ ILKDP Sbjct: 1 MGAPKQKWTSEEEGALRAGVEKYGSGKWQTILKDP 35 >ref|XP_006352110.1| PREDICTED: telomere repeat-binding factor 1-like isoform X1 [Solanum tuberosum] gi|565371022|ref|XP_006352111.1| PREDICTED: telomere repeat-binding factor 1-like isoform X2 [Solanum tuberosum] gi|565371024|ref|XP_006352112.1| PREDICTED: telomere repeat-binding factor 1-like isoform X3 [Solanum tuberosum] gi|565371026|ref|XP_006352113.1| PREDICTED: telomere repeat-binding factor 1-like isoform X4 [Solanum tuberosum] gi|565371028|ref|XP_006352114.1| PREDICTED: telomere repeat-binding factor 1-like isoform X5 [Solanum tuberosum] Length = 300 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT+EEE+AL+AG+ K+GPGKWR ILKDP Sbjct: 1 MGAPKQKWTSEEEAALKAGILKHGPGKWRTILKDP 35 >ref|XP_006393200.1| hypothetical protein EUTSA_v10011686mg [Eutrema salsugineum] gi|567133327|ref|XP_006393201.1| hypothetical protein EUTSA_v10011686mg [Eutrema salsugineum] gi|567133331|ref|XP_006393202.1| hypothetical protein EUTSA_v10011686mg [Eutrema salsugineum] gi|557089778|gb|ESQ30486.1| hypothetical protein EUTSA_v10011686mg [Eutrema salsugineum] gi|557089779|gb|ESQ30487.1| hypothetical protein EUTSA_v10011686mg [Eutrema salsugineum] gi|557089780|gb|ESQ30488.1| hypothetical protein EUTSA_v10011686mg [Eutrema salsugineum] Length = 307 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT EEESAL++GV K+GPGKWR ILKDP Sbjct: 1 MGAPKQKWTQEEESALKSGVIKHGPGKWRTILKDP 35 >ref|XP_006303249.1| hypothetical protein CARUB_v10009836mg [Capsella rubella] gi|482571960|gb|EOA36147.1| hypothetical protein CARUB_v10009836mg [Capsella rubella] Length = 307 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT EEESAL++GV K+GPGKWR ILKDP Sbjct: 1 MGAPKQKWTQEEESALKSGVIKHGPGKWRTILKDP 35 >ref|XP_004250736.1| PREDICTED: telomere repeat-binding factor 1-like isoform 4 [Solanum lycopersicum] Length = 300 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT+EEE+AL+AG+ K+GPGKWR ILKDP Sbjct: 1 MGAPKQKWTSEEEAALKAGILKHGPGKWRTILKDP 35 >ref|XP_004250733.1| PREDICTED: telomere repeat-binding factor 1-like isoform 1 [Solanum lycopersicum] gi|460410648|ref|XP_004250734.1| PREDICTED: telomere repeat-binding factor 1-like isoform 2 [Solanum lycopersicum] gi|460410650|ref|XP_004250735.1| PREDICTED: telomere repeat-binding factor 1-like isoform 3 [Solanum lycopersicum] Length = 324 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT+EEE+AL+AG+ K+GPGKWR ILKDP Sbjct: 1 MGAPKQKWTSEEEAALKAGILKHGPGKWRTILKDP 35 >gb|AAF76448.1|AC015445_15 Contains similarity to DNA-binding protein MYB1 from Petroselinum crispum gi|7488946 and contains MYB-DNA-binding PF|00249 and linker-Histone PF|00538 domains [Arabidopsis thaliana] Length = 318 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT EEESAL++GV K+GPGKWR ILKDP Sbjct: 1 MGAPKQKWTQEEESALKSGVIKHGPGKWRTILKDP 35 >ref|XP_002894224.1| telomere repeat binding factor 1 [Arabidopsis lyrata subsp. lyrata] gi|297340066|gb|EFH70483.1| telomere repeat binding factor 1 [Arabidopsis lyrata subsp. lyrata] Length = 300 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT EEESAL++GV K+GPGKWR ILKDP Sbjct: 1 MGAPKQKWTQEEESALKSGVIKHGPGKWRTILKDP 35 >gb|AAL73438.1|U83624_1 telomere repeat binding factor 1 [Arabidopsis thaliana] Length = 300 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT EEESAL++GV K+GPGKWR ILKDP Sbjct: 1 MGAPKQKWTQEEESALKSGVIKHGPGKWRTILKDP 35 >gb|AAM65540.1| DNA-binding protein PcMYB1, putative [Arabidopsis thaliana] Length = 300 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT EEESAL++GV K+GPGKWR ILKDP Sbjct: 1 MGAPKQKWTQEEESALKSGVIKHGPGKWRTILKDP 35 >ref|NP_564559.1| telomere repeat binding factor 1 [Arabidopsis thaliana] gi|30694688|ref|NP_849789.1| telomere repeat binding factor 1 [Arabidopsis thaliana] gi|42571815|ref|NP_973998.1| telomere repeat binding factor 1 [Arabidopsis thaliana] gi|75331085|sp|Q8VWK4.1|TRB1_ARATH RecName: Full=Telomere repeat-binding factor 1; Short=AtTRB1; AltName: Full=MYB transcription factor gi|18478312|gb|AAL73123.1|U83623_1 telomere repeat binding factor 1 [Arabidopsis thaliana] gi|17065320|gb|AAL32814.1| Unknown protein [Arabidopsis thaliana] gi|32362301|gb|AAP80178.1| At1g49950 [Arabidopsis thaliana] gi|41619040|gb|AAS10009.1| MYB transcription factor [Arabidopsis thaliana] gi|332194376|gb|AEE32497.1| telomere repeat binding factor 1 [Arabidopsis thaliana] gi|332194377|gb|AEE32498.1| telomere repeat binding factor 1 [Arabidopsis thaliana] gi|332194378|gb|AEE32499.1| telomere repeat binding factor 1 [Arabidopsis thaliana] Length = 300 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 109 MGAPKQKWTNEEESALRAGVEKYGPGKWRAILKDP 5 MGAPKQKWT EEESAL++GV K+GPGKWR ILKDP Sbjct: 1 MGAPKQKWTQEEESALKSGVIKHGPGKWRTILKDP 35