BLASTX nr result
ID: Ephedra28_contig00021328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00021328 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006855341.1| hypothetical protein AMTR_s00057p00096030 [A... 67 3e-09 ref|XP_002512478.1| kinesin heavy chain, putative [Ricinus commu... 57 3e-06 ref|XP_006355844.1| PREDICTED: kinesin-4-like [Solanum tuberosum] 55 7e-06 >ref|XP_006855341.1| hypothetical protein AMTR_s00057p00096030 [Amborella trichopoda] gi|548859107|gb|ERN16808.1| hypothetical protein AMTR_s00057p00096030 [Amborella trichopoda] Length = 1075 Score = 66.6 bits (161), Expect = 3e-09 Identities = 49/131 (37%), Positives = 74/131 (56%), Gaps = 22/131 (16%) Frame = +2 Query: 2 NVQPSPDS--------KSLPMQPEFSPSQGLDKKEALQLFSLAGMDMS------------ 121 NV+PS +S K+L P Q DK + FSL+ + S Sbjct: 199 NVKPSKNSDPFMNSLSKNLYQTDPSGPQQMDDKGQ--NGFSLSRQNSSANLSLDSTEVTP 256 Query: 122 -SPAFTKLIQHMDSNKKLQEMPNFVESMIGKVVEEVERRLTSQ-EQLKKAIKDIVANGEE 295 S + L++ S++K +E+P VESM+ KV+EE ERRL +Q +QLK +KD+VA+G++ Sbjct: 257 GSHSLNTLVRAALSDRKPEEVPCLVESMLSKVMEEFERRLATQSDQLKTVLKDLVASGDK 316 Query: 296 VSLPKSKILAS 328 SLPK+K+LA+ Sbjct: 317 KSLPKAKVLAA 327 >ref|XP_002512478.1| kinesin heavy chain, putative [Ricinus communis] gi|223548439|gb|EEF49930.1| kinesin heavy chain, putative [Ricinus communis] Length = 1051 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/59 (47%), Positives = 45/59 (76%), Gaps = 1/59 (1%) Frame = +2 Query: 140 LIQHMDSNKKLQEMPNFVESMIGKVVEEVERRLTSQEQL-KKAIKDIVANGEEVSLPKS 313 L++ + +NK +E+P+ VESM+ KV+EE ERRL SQ++L K A KD+ A+G ++SL ++ Sbjct: 229 LVRAVLANKNQEELPSIVESMLNKVMEEFERRLASQQELIKSAAKDMAASGPDMSLERT 287 >ref|XP_006355844.1| PREDICTED: kinesin-4-like [Solanum tuberosum] Length = 1005 Score = 55.5 bits (132), Expect = 7e-06 Identities = 33/81 (40%), Positives = 51/81 (62%), Gaps = 1/81 (1%) Frame = +2 Query: 29 SLPMQPEFSPSQGLDKKEALQLFSLAGMD-MSSPAFTKLIQHMDSNKKLQEMPNFVESMI 205 S P S S +++K + + A + MSS + + L++ + +KK +E+PN VES++ Sbjct: 192 SEPFSSSLSRSMSMNEKSTNGVCTEAESNKMSSSSLSNLVRAILIDKKPEEVPNLVESVL 251 Query: 206 GKVVEEVERRLTSQEQLKKAI 268 KVVEE E+R+TSQ QL KAI Sbjct: 252 NKVVEEFEQRITSQIQLNKAI 272