BLASTX nr result
ID: Ephedra28_contig00021317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00021317 (364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511324.1| leucine-rich repeat-containing protein, puta... 59 5e-07 ref|XP_006296704.1| hypothetical protein CARUB_v10013520mg [Caps... 57 3e-06 ref|XP_002318047.2| hypothetical protein POPTR_0012s08760g [Popu... 55 7e-06 >ref|XP_002511324.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223550439|gb|EEF51926.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 519 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = +1 Query: 217 AERAKAISEVSQIRDVLSSLGYKPDHESVDAARVSLSQIESKLSEELDE 363 A +AIS+VSQ R VL +LG +PDHE+VD AR+ L++IES LS++L+E Sbjct: 67 ASMTRAISDVSQTRSVLQTLGPRPDHETVDNARIKLAEIESDLSKQLEE 115 >ref|XP_006296704.1| hypothetical protein CARUB_v10013520mg [Capsella rubella] gi|482565413|gb|EOA29602.1| hypothetical protein CARUB_v10013520mg [Capsella rubella] Length = 498 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +1 Query: 217 AERAKAISEVSQIRDVLSSLGYKPDHESVDAARVSLSQIESKLSEELDE 363 A AIS+V++ R +L +LG +PDHESVD ARV LS+IES LSE ++ Sbjct: 64 ASMTSAISDVAETRSILRTLGPRPDHESVDKARVKLSEIESSLSESFED 112 >ref|XP_002318047.2| hypothetical protein POPTR_0012s08760g [Populus trichocarpa] gi|550326685|gb|EEE96267.2| hypothetical protein POPTR_0012s08760g [Populus trichocarpa] Length = 510 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/45 (51%), Positives = 38/45 (84%) Frame = +1 Query: 229 KAISEVSQIRDVLSSLGYKPDHESVDAARVSLSQIESKLSEELDE 363 +A+ +V+Q R +L +LG +PDHE+VDAA++ +S+IES LS+EL++ Sbjct: 61 RAVGDVAQTRSILQTLGPRPDHETVDAAKLKVSEIESNLSKELED 105