BLASTX nr result
ID: Ephedra28_contig00020889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00020889 (425 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR17732.1| unknown [Picea sitchensis] 75 9e-12 ref|XP_006848234.1| hypothetical protein AMTR_s00029p00247460 [A... 65 9e-09 ref|XP_002279840.1| PREDICTED: dihydrodipicolinate synthase 2, c... 61 2e-07 ref|XP_002982898.1| hypothetical protein SELMODRAFT_117275 [Sela... 60 3e-07 gb|EPS62127.1| dihydrodipicolinate synthase, chloroplastic, part... 60 4e-07 ref|XP_002981920.1| hypothetical protein SELMODRAFT_179125 [Sela... 59 7e-07 gb|EMJ19364.1| hypothetical protein PRUPE_ppa007510mg [Prunus pe... 58 1e-06 ref|XP_004234671.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 58 1e-06 ref|XP_006433582.1| hypothetical protein CICLE_v10001621mg [Citr... 57 2e-06 gb|ESW11982.1| hypothetical protein PHAVU_008G075400g [Phaseolus... 57 3e-06 ref|XP_003534605.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 57 3e-06 gb|ACU23971.1| unknown [Glycine max] 57 3e-06 ref|XP_006362380.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 57 3e-06 gb|EMT33431.1| Dihydrodipicolinate synthase 2, chloroplastic [Ae... 57 3e-06 sp|P24847.1|DAPA2_WHEAT RecName: Full=4-hydroxy-tetrahydrodipico... 57 3e-06 gb|AFK35620.1| unknown [Medicago truncatula] 57 3e-06 ref|XP_006472249.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 56 4e-06 ref|XP_006433583.1| hypothetical protein CICLE_v10001621mg [Citr... 56 4e-06 dbj|BAK03225.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 4e-06 sp|P24846.1|DAPA1_WHEAT RecName: Full=4-hydroxy-tetrahydrodipico... 56 6e-06 >gb|ABR17732.1| unknown [Picea sitchensis] Length = 359 Score = 75.1 bits (183), Expect = 9e-12 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -2 Query: 154 QPKRLNKMLLPARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 Q K +K PARAA MQDV+LPMRS ELKNRT++DEIKKL+LITA+KTPY Sbjct: 20 QGKSESKRWRPARAATMQDVHLPMRSFELKNRTQVDEIKKLRLITAIKTPY 70 >ref|XP_006848234.1| hypothetical protein AMTR_s00029p00247460 [Amborella trichopoda] gi|548851539|gb|ERN09815.1| hypothetical protein AMTR_s00029p00247460 [Amborella trichopoda] Length = 366 Score = 65.1 bits (157), Expect = 9e-09 Identities = 35/67 (52%), Positives = 46/67 (68%) Frame = -2 Query: 202 SMTATFSPPLIMGKTTQPKRLNKMLLPARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLI 23 S T S + KT +R+ K + RAAV+ + +LPMRS E+KNRT +DEIKKL+LI Sbjct: 13 SSTTQLSLHTVANKTK--RRIPKRWISPRAAVVHNFHLPMRSLEVKNRTPVDEIKKLRLI 70 Query: 22 TAVKTPY 2 TA+KTPY Sbjct: 71 TAIKTPY 77 >ref|XP_002279840.1| PREDICTED: dihydrodipicolinate synthase 2, chloroplastic [Vitis vinifera] gi|296089164|emb|CBI38867.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -2 Query: 148 KRLNKMLLPARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 KR N A+AAV+ + +LPMRS E+KNRT +D+IK L+LITA+KTPY Sbjct: 28 KRRNAKWKSAQAAVIPNFHLPMRSFEVKNRTSVDDIKSLRLITAIKTPY 76 >ref|XP_002982898.1| hypothetical protein SELMODRAFT_117275 [Selaginella moellendorffii] gi|300149488|gb|EFJ16143.1| hypothetical protein SELMODRAFT_117275 [Selaginella moellendorffii] Length = 368 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -2 Query: 136 KMLLPARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 K L RAAVMQ LPMRS+ELKN T ++E+KKL+LI+A+KTPY Sbjct: 35 KACLQIRAAVMQSTPLPMRSNELKNSTPVEEMKKLRLISAIKTPY 79 >gb|EPS62127.1| dihydrodipicolinate synthase, chloroplastic, partial [Genlisea aurea] Length = 341 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 124 PARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 PARA + + +LPMRS+E+KNRT +D+IK L+LITA+KTPY Sbjct: 11 PARAVLAPNFHLPMRSNEVKNRTNVDDIKSLRLITAIKTPY 51 >ref|XP_002981920.1| hypothetical protein SELMODRAFT_179125 [Selaginella moellendorffii] gi|300150362|gb|EFJ17013.1| hypothetical protein SELMODRAFT_179125 [Selaginella moellendorffii] Length = 368 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -2 Query: 127 LPARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 L RAAVMQ LPMRS+ELKN T ++E+KKL+LI+A+KTPY Sbjct: 38 LQIRAAVMQSTPLPMRSNELKNSTPVEEMKKLRLISAIKTPY 79 >gb|EMJ19364.1| hypothetical protein PRUPE_ppa007510mg [Prunus persica] Length = 365 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -2 Query: 118 RAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 RAAV+ + +LPMRS E+KNRT +D+IK L+LITA+KTPY Sbjct: 38 RAAVIPNFHLPMRSFEVKNRTSVDDIKSLRLITAIKTPY 76 >ref|XP_004234671.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic-like [Solanum lycopersicum] Length = 357 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -2 Query: 145 RLNKMLLPARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 R N RAAV+ ++LPMRS+E+KNRT ++IKKL+LITA+KTPY Sbjct: 21 RRNATWKSPRAAVIPSIHLPMRSNEVKNRTFAEDIKKLRLITAIKTPY 68 >ref|XP_006433582.1| hypothetical protein CICLE_v10001621mg [Citrus clementina] gi|557535704|gb|ESR46822.1| hypothetical protein CICLE_v10001621mg [Citrus clementina] Length = 346 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = -2 Query: 145 RLNKMLLPARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 R N+ P +AA++ + +LPMRS E+KNRT ++IK L+LITA+KTPY Sbjct: 10 RKNRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPY 57 >gb|ESW11982.1| hypothetical protein PHAVU_008G075400g [Phaseolus vulgaris] Length = 363 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/71 (46%), Positives = 41/71 (57%) Frame = -2 Query: 214 RAMESMTATFSPPLIMGKTTQPKRLNKMLLPARAAVMQDVYLPMRSHELKNRTKIDEIKK 35 + + ATF P T N P +AAV ++LPMRS ELKNRT +EIK Sbjct: 5 KTLSFRAATF-PDCPSNVTNYTNTRNSNWKPPQAAVKPSLHLPMRSFELKNRTSPEEIKC 63 Query: 34 LQLITAVKTPY 2 L+LITA+KTPY Sbjct: 64 LRLITAIKTPY 74 >ref|XP_003534605.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic-like [Glycine max] Length = 363 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 124 PARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 PA+AAV + +LPMRS ELKNRT ++IK L+LITA+KTPY Sbjct: 34 PAQAAVKPNFHLPMRSFELKNRTSPEDIKALRLITAIKTPY 74 >gb|ACU23971.1| unknown [Glycine max] Length = 363 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 124 PARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 PA+AAV + +LPMRS ELKNRT ++IK L+LITA+KTPY Sbjct: 34 PAQAAVKPNFHLPMRSFELKNRTSPEDIKALRLITAIKTPY 74 >ref|XP_006362380.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic-like [Solanum tuberosum] Length = 357 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = -2 Query: 118 RAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 RAAV+ ++LPMRS+E+KNRT ++IKKL+LITA+KTPY Sbjct: 30 RAAVIPCIHLPMRSNEVKNRTFAEDIKKLRLITAIKTPY 68 >gb|EMT33431.1| Dihydrodipicolinate synthase 2, chloroplastic [Aegilops tauschii] Length = 400 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 115 AAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 AA+ D YLPMRS E+KNRT +D IK L+LITAVKTPY Sbjct: 74 AAITTDDYLPMRSTEVKNRTSVDGIKSLRLITAVKTPY 111 >sp|P24847.1|DAPA2_WHEAT RecName: Full=4-hydroxy-tetrahydrodipicolinate synthase 2, chloroplastic; Short=HTPA synthase 2; Flags: Precursor gi|170682|gb|AAA34264.1| dihydrodipicolinate synthase [Triticum aestivum] Length = 377 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 115 AAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 AA+ D YLPMRS E+KNRT +D IK L+LITAVKTPY Sbjct: 51 AAITTDDYLPMRSTEVKNRTSVDGIKSLRLITAVKTPY 88 >gb|AFK35620.1| unknown [Medicago truncatula] Length = 234 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/53 (52%), Positives = 36/53 (67%) Frame = -2 Query: 160 TTQPKRLNKMLLPARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 TT N P +AAV + +LPMRS E+KNRT ++IK L+LITA+KTPY Sbjct: 25 TTNKNSRNSYWRPTQAAVKSNFHLPMRSFEMKNRTCTEDIKCLRLITAIKTPY 77 >ref|XP_006472249.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic-like [Citrus sinensis] Length = 359 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -2 Query: 139 NKMLLPARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 N+ P +AA++ + +LPMRS E+KNRT ++IK L+LITA+KTPY Sbjct: 25 NRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPY 70 >ref|XP_006433583.1| hypothetical protein CICLE_v10001621mg [Citrus clementina] gi|557535705|gb|ESR46823.1| hypothetical protein CICLE_v10001621mg [Citrus clementina] Length = 359 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -2 Query: 139 NKMLLPARAAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 N+ P +AA++ + +LPMRS E+KNRT ++IK L+LITA+KTPY Sbjct: 25 NRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPY 70 >dbj|BAK03225.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 377 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 115 AAVMQDVYLPMRSHELKNRTKIDEIKKLQLITAVKTPY 2 AA+ D YLPMRS E+KNRT +D IK L+LITA+KTPY Sbjct: 51 AAITTDDYLPMRSTEVKNRTSVDGIKSLRLITAIKTPY 88 >sp|P24846.1|DAPA1_WHEAT RecName: Full=4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic; Short=HTPA synthase 1; Flags: Precursor gi|170680|gb|AAA34263.1| dihydrodipicolinate synthase [Triticum aestivum] Length = 388 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/72 (48%), Positives = 40/72 (55%) Frame = -2 Query: 217 FRAMESMTATFSPPLIMGKTTQPKRLNKMLLPARAAVMQDVYLPMRSHELKNRTKIDEIK 38 F A S + P + G + K A AAV D YLPMRS E+KNRT D IK Sbjct: 31 FPAGTSRSGRLQPVPVSGHSASRVSKGKF---AVAAVTLDDYLPMRSTEVKNRTSTDGIK 87 Query: 37 KLQLITAVKTPY 2 L+LITAVKTPY Sbjct: 88 SLRLITAVKTPY 99