BLASTX nr result
ID: Ephedra28_contig00020873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00020873 (585 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004241451.1| PREDICTED: auxin-induced protein 10A5-like [... 56 8e-06 >ref|XP_004241451.1| PREDICTED: auxin-induced protein 10A5-like [Solanum lycopersicum] Length = 170 Score = 55.8 bits (133), Expect = 8e-06 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +2 Query: 23 MAPKGCFGVR-SLDGNKVYIQTRHLKHPLMKKMLEMAESEYGHCDSGLPITIPYDLSTFH 199 +AP+GCF V + K I+ ++ HPL K +LE AE EYG+C G PI +P D++ FH Sbjct: 53 LAPQGCFCVYVGPEKEKFTIKAKYANHPLFKMLLEDAEMEYGYCSQG-PILLPCDVNLFH 111 Query: 200 HLL 208 +L Sbjct: 112 KVL 114