BLASTX nr result
ID: Ephedra28_contig00020620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00020620 (594 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447773.1| hypothetical protein SORBIDRAFT_06g015370 [S... 56 6e-06 >ref|XP_002447773.1| hypothetical protein SORBIDRAFT_06g015370 [Sorghum bicolor] gi|241938956|gb|EES12101.1| hypothetical protein SORBIDRAFT_06g015370 [Sorghum bicolor] Length = 380 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = -3 Query: 157 RTCKRYLHNYCKSGRVREARELVNTMLKNDMVPDVVSYSSLITAYCKRGDF 5 R+ LH YCK GRV EA LV+TM++ PDV+SYS LI C+ G+F Sbjct: 185 RSYTAILHGYCKQGRVLEAERLVDTMIQVGCAPDVISYSVLIQGLCRVGEF 235