BLASTX nr result
ID: Ephedra28_contig00020589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00020589 (382 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY28176.1| Uncharacterized protein TCM_029816 [Theobroma cacao] 57 3e-06 >gb|EOY28176.1| Uncharacterized protein TCM_029816 [Theobroma cacao] Length = 44 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +2 Query: 65 MLELFVLSCTGVVVLLHGAHIFFQWMFKHAAVQALSFLMHVG 190 M+ELFVL CTGVVV LHGA+ FF + +H AV++LSFL VG Sbjct: 2 MVELFVLGCTGVVVFLHGANFFFHILSQHLAVRSLSFLGFVG 43