BLASTX nr result
ID: Ephedra28_contig00020095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00020095 (612 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382527.1| hypothetical protein POPTR_0005s030202g, par... 58 2e-06 >ref|XP_006382527.1| hypothetical protein POPTR_0005s030202g, partial [Populus trichocarpa] gi|550337890|gb|ERP60324.1| hypothetical protein POPTR_0005s030202g, partial [Populus trichocarpa] Length = 1241 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/77 (40%), Positives = 43/77 (55%) Frame = -1 Query: 603 CEGLKCLPKSFGQLSSLMVLHMQGCIXXXXXXXXXXXXXXLRFLTLDGCTGLEKLPDDLE 424 C GL+ LP S G+L L +L++ GC+ L L L GC+GLE LPD ++ Sbjct: 837 CLGLESLPDSIGELRCLTMLNLSGCLKLTSLPDSIGMLKCLYVLHLTGCSGLESLPDSID 896 Query: 423 EFLPCLLVMDIRGCDEL 373 E L CL +D+ GC +L Sbjct: 897 E-LRCLTTLDLSGCLKL 912