BLASTX nr result
ID: Ephedra28_contig00019719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00019719 (502 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006473420.1| PREDICTED: probable E3 ubiquitin-protein lig... 55 7e-06 ref|XP_006473419.1| PREDICTED: probable E3 ubiquitin-protein lig... 55 7e-06 ref|XP_006434912.1| hypothetical protein CICLE_v10000795mg [Citr... 55 7e-06 >ref|XP_006473420.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI2-like isoform X2 [Citrus sinensis] Length = 476 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = -1 Query: 289 FNWLCGATTGGAHTMTRIGGHECDHYKEEREKEASKLSRA 170 F WLCGA TG HT T I GH C YKE+REKE R+ Sbjct: 253 FCWLCGAATGSDHTWTSIAGHSCGRYKEDREKETESAKRS 292 >ref|XP_006473419.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI2-like isoform X1 [Citrus sinensis] Length = 542 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = -1 Query: 289 FNWLCGATTGGAHTMTRIGGHECDHYKEEREKEASKLSRA 170 F WLCGA TG HT T I GH C YKE+REKE R+ Sbjct: 319 FCWLCGAATGSDHTWTSIAGHSCGRYKEDREKETESAKRS 358 >ref|XP_006434912.1| hypothetical protein CICLE_v10000795mg [Citrus clementina] gi|567884709|ref|XP_006434913.1| hypothetical protein CICLE_v10000795mg [Citrus clementina] gi|557537034|gb|ESR48152.1| hypothetical protein CICLE_v10000795mg [Citrus clementina] gi|557537035|gb|ESR48153.1| hypothetical protein CICLE_v10000795mg [Citrus clementina] Length = 540 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = -1 Query: 289 FNWLCGATTGGAHTMTRIGGHECDHYKEEREKEASKLSRA 170 F WLCGA TG HT T I GH C YKE+REKE R+ Sbjct: 317 FCWLCGAATGSDHTWTSIAGHSCGRYKEDREKETESAKRS 356