BLASTX nr result
ID: Ephedra28_contig00019607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00019607 (613 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521125.1| transferase, transferring glycosyl groups, p... 56 9e-06 >ref|XP_002521125.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223539694|gb|EEF41276.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 626 Score = 55.8 bits (133), Expect = 9e-06 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = +3 Query: 3 AKAMEDEDGVSGAVKAFHKHLPKKMPQPVTTLQEQNHFVDSFFSGIGKIFGCA 161 AKAME+EDGV+GAVKAF KHLP+K P+P + + S F + FGC+ Sbjct: 578 AKAMENEDGVTGAVKAFFKHLPRKKPEP----EPETSLEHSSFFSFSRCFGCS 626