BLASTX nr result
ID: Ephedra28_contig00019605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00019605 (415 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR17890.1| unknown [Picea sitchensis] 57 2e-06 gb|EPS72357.1| hypothetical protein M569_02403, partial [Genlise... 57 3e-06 ref|XP_006354405.1| PREDICTED: uncharacterized protein LOC102589... 56 4e-06 >gb|ABR17890.1| unknown [Picea sitchensis] Length = 85 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 304 YDILMAKIYGLLGKEYRRPERIPPACPIKPSNK 402 +D+LM KIY L GKEYRRPER+P ACP KP++K Sbjct: 23 FDLLMGKIYALFGKEYRRPERVPAACPYKPASK 55 >gb|EPS72357.1| hypothetical protein M569_02403, partial [Genlisea aurea] Length = 64 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +1 Query: 304 YDILMAKIYGLLGKEYRRPERIPPACPIKPSN 399 +D +MAK+Y LLGKEY+RPER PP CP+KPS+ Sbjct: 23 FDFVMAKVYRLLGKEYQRPERAPPVCPVKPSS 54 >ref|XP_006354405.1| PREDICTED: uncharacterized protein LOC102589244 [Solanum tuberosum] Length = 150 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +1 Query: 304 YDILMAKIYGLLGKEYRRPERIPPACPIKPSNKNKSN 414 + ILMAK+Y ++GKEY+RPER PPACP KPS +N Sbjct: 87 FHILMAKVYRMMGKEYQRPERAPPACPFKPSATKPNN 123