BLASTX nr result
ID: Ephedra28_contig00019478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00019478 (722 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845498.1| hypothetical protein AMTR_s00019p00152360 [A... 57 5e-06 >ref|XP_006845498.1| hypothetical protein AMTR_s00019p00152360 [Amborella trichopoda] gi|548848070|gb|ERN07173.1| hypothetical protein AMTR_s00019p00152360 [Amborella trichopoda] Length = 720 Score = 57.4 bits (137), Expect = 5e-06 Identities = 23/43 (53%), Positives = 32/43 (74%) Frame = +3 Query: 594 GKQSGTSDLSKAKVFAEDHEPLTKRIFDPGNELVQNWNKIFLI 722 G+ + S+L ++K F EDHEP KRI DPG+E+V WN++FLI Sbjct: 51 GRLAANSNLGRSKAFVEDHEPWRKRILDPGSEIVLQWNRVFLI 93