BLASTX nr result
ID: Ephedra28_contig00018335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00018335 (421 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002974435.1| hypothetical protein SELMODRAFT_101161 [Sela... 57 3e-06 ref|XP_002985732.1| hypothetical protein SELMODRAFT_122762 [Sela... 57 3e-06 >ref|XP_002974435.1| hypothetical protein SELMODRAFT_101161 [Selaginella moellendorffii] gi|300158033|gb|EFJ24657.1| hypothetical protein SELMODRAFT_101161 [Selaginella moellendorffii] Length = 642 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 331 YVGDLDQSVTESQLYDVFNRVAPVLSIRVC 420 YVGDLD +VTE QLYDVFN+VAPVLSIRVC Sbjct: 40 YVGDLDPNVTEGQLYDVFNQVAPVLSIRVC 69 >ref|XP_002985732.1| hypothetical protein SELMODRAFT_122762 [Selaginella moellendorffii] gi|300146641|gb|EFJ13310.1| hypothetical protein SELMODRAFT_122762 [Selaginella moellendorffii] Length = 635 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 331 YVGDLDQSVTESQLYDVFNRVAPVLSIRVC 420 YVGDLD +VTE QLYDVFN+VAPVLSIRVC Sbjct: 40 YVGDLDPNVTEGQLYDVFNQVAPVLSIRVC 69