BLASTX nr result
ID: Ephedra28_contig00018184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00018184 (828 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280765.1| PREDICTED: scarecrow-like protein 14 [Vitis ... 57 8e-06 >ref|XP_002280765.1| PREDICTED: scarecrow-like protein 14 [Vitis vinifera] Length = 704 Score = 57.0 bits (136), Expect = 8e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +2 Query: 2 HKDFGVDQDGGWMLHGWKGRIINALTIWVPDS 97 HKDF VD+DGGWML GWKGRII A++ W P S Sbjct: 671 HKDFVVDEDGGWMLQGWKGRIIYAISCWKPHS 702