BLASTX nr result
ID: Ephedra28_contig00018140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00018140 (392 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22861.1| unknown [Picea sitchensis] gi|116791830|gb|ABK261... 65 9e-09 gb|AFG55747.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|... 64 3e-08 gb|AFG55749.1| hypothetical protein 0_12568_01 [Pinus taeda] 63 5e-08 >gb|ABK22861.1| unknown [Picea sitchensis] gi|116791830|gb|ABK26124.1| unknown [Picea sitchensis] Length = 137 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/67 (46%), Positives = 39/67 (58%) Frame = +3 Query: 192 AHAAQPQPDGPVQGKEWEMHAIPWEVDVGMQRAFNGTMRNRRRLGTFKLCALCTCCGGHH 371 A+ + P+G WEM P E + FN T RR+LGTF++C+LCTCCGG H Sbjct: 46 ANCSNTIPEGSRNHTTWEMRPFPSEASY---QIFNET---RRKLGTFQICSLCTCCGGRH 99 Query: 372 RLCFPSP 392 LC PSP Sbjct: 100 HLCLPSP 106 >gb|AFG55747.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|383147968|gb|AFG55748.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|383147972|gb|AFG55750.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|383147974|gb|AFG55751.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|383147976|gb|AFG55752.1| hypothetical protein 0_12568_01 [Pinus taeda] gi|383147978|gb|AFG55753.1| hypothetical protein 0_12568_01 [Pinus taeda] Length = 95 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/67 (44%), Positives = 38/67 (56%) Frame = +3 Query: 192 AHAAQPQPDGPVQGKEWEMHAIPWEVDVGMQRAFNGTMRNRRRLGTFKLCALCTCCGGHH 371 A+ + P+G WEM P E + N T RR+LGTF++C+LCTCCGG H Sbjct: 4 ANCSNTIPEGSGNHSAWEMRPFPSEASY---QVLNET---RRKLGTFQICSLCTCCGGRH 57 Query: 372 RLCFPSP 392 LC PSP Sbjct: 58 HLCLPSP 64 >gb|AFG55749.1| hypothetical protein 0_12568_01 [Pinus taeda] Length = 95 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/67 (44%), Positives = 38/67 (56%) Frame = +3 Query: 192 AHAAQPQPDGPVQGKEWEMHAIPWEVDVGMQRAFNGTMRNRRRLGTFKLCALCTCCGGHH 371 A+ + P+G WEM P E + N T RR+LGTF++C+LCTCCGG H Sbjct: 4 ANCSNTIPEGLGNHSAWEMRPFPSEASY---QVLNET---RRKLGTFQICSLCTCCGGRH 57 Query: 372 RLCFPSP 392 LC PSP Sbjct: 58 HLCLPSP 64