BLASTX nr result
ID: Ephedra28_contig00017809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00017809 (404 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003022883.1| conserved hypothetical protein [Trichophyton... 59 7e-07 ref|XP_003921305.1| PREDICTED: AT-rich interactive domain-contai... 57 2e-06 gb|EFN77427.1| SWI/SNF-related matrix-associated actin-dependent... 55 7e-06 >ref|XP_003022883.1| conserved hypothetical protein [Trichophyton verrucosum HKI 0517] gi|291186853|gb|EFE42265.1| conserved hypothetical protein [Trichophyton verrucosum HKI 0517] Length = 698 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/92 (35%), Positives = 43/92 (46%) Frame = +2 Query: 2 RQHQPQAYNNQLKQPHRSAHYQQAQHSQMHHSEQPPPHGQIPQAQQRMSLPPDSHPKFPS 181 +QHQPQ ++NQ + QQ QH HH + PPH PQ PP SHP Sbjct: 315 QQHQPQPHHNQQHHQQQQQQQQQQQHPPPHHHQPRPPHQHHPQQPS----PPPSHPPITI 370 Query: 182 YPPGPSQSQWKQQASTEYLNQSSRRRNYTLPL 277 Y P P+ Q Q +TE L + S + P+ Sbjct: 371 YAPNPAHHQ--PQMNTESLPRLSTASDMHHPI 400 >ref|XP_003921305.1| PREDICTED: AT-rich interactive domain-containing protein 1A [Saimiri boliviensis boliviensis] Length = 1682 Score = 57.4 bits (137), Expect = 2e-06 Identities = 37/102 (36%), Positives = 47/102 (46%), Gaps = 3/102 (2%) Frame = +2 Query: 5 QHQPQAYNNQLKQPHRSAHYQQAQHSQMHHSEQPP---PHGQIPQAQQRMSLPPDSHPKF 175 Q P Y Q + P+ + Q Q +S+QPP PHGQ QQ S PP P Sbjct: 73 QQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHGQPSYQQQPQSQPPQLQPSQ 132 Query: 176 PSYPPGPSQSQWKQQASTEYLNQSSRRRNYTLPLPPIQSQPK 301 P Y PSQ QQ+ T Y +Q S + + PP SQP+ Sbjct: 133 PPYSQQPSQPP-HQQSPTPYPSQQSTTQQHPQSQPP-YSQPQ 172 >gb|EFN77427.1| SWI/SNF-related matrix-associated actin-dependent regulator chromatin subfamily E member 1 [Harpegnathos saltator] Length = 777 Score = 55.5 bits (132), Expect = 7e-06 Identities = 35/99 (35%), Positives = 46/99 (46%), Gaps = 2/99 (2%) Frame = +2 Query: 5 QHQPQAYNNQLKQP--HRSAHYQQAQHSQMHHSEQPPPHGQIPQAQQRMSLPPDSHPKFP 178 QHQP + QP H+ +Q QH H QPPP Q QQ LPP Sbjct: 431 QHQPPQHQPPQHQPPQHQPPQHQPPQHQPPQH--QPPPQHQPTTPQQSHQLPPPQQQHQA 488 Query: 179 SYPPGPSQSQWKQQASTEYLNQSSRRRNYTLPLPPIQSQ 295 PP P Q Q +QQ ++ Q +++++ P PP QSQ Sbjct: 489 PPPPPPQQQQQQQQQQQQHQPQPTQQQHQ--PPPPPQSQ 525