BLASTX nr result
ID: Ephedra28_contig00017786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00017786 (580 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002970126.1| EPF-type Cis2-His2 zinc finger transcription... 67 3e-09 ref|XP_002985202.1| EPF-type Cis2-His2 zinc finger transcription... 67 3e-09 ref|XP_002984343.1| EPF-type Cis2-His2 zinc finger transcription... 66 7e-09 gb|ADE75910.1| unknown [Picea sitchensis] 65 1e-08 gb|ESW32897.1| hypothetical protein PHAVU_001G026700g [Phaseolus... 65 1e-08 ref|XP_002972767.1| EPF-type Cis2-His2 zinc finger transcription... 65 2e-08 gb|ACA52107.1| zinc finger protein ZFP248 [Arachis hypogaea] 65 2e-08 dbj|BAA19114.1| PEThy;ZPT4-1 [Petunia x hybrida] 64 3e-08 ref|XP_002511650.1| conserved hypothetical protein [Ricinus comm... 64 4e-08 ref|XP_002540465.1| conserved hypothetical protein [Ricinus comm... 64 4e-08 emb|CAF74935.1| zinc finger DNA-binding protein [Catharanthus ro... 63 5e-08 gb|EOX96331.1| C2H2-type zinc finger family protein [Theobroma c... 62 8e-08 ref|XP_004240265.1| PREDICTED: uncharacterized protein LOC101264... 62 8e-08 emb|CBI16587.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_002278612.1| PREDICTED: uncharacterized protein LOC100247... 62 8e-08 ref|XP_006445329.1| hypothetical protein CICLE_v10024047mg [Citr... 62 1e-07 gb|EXB37568.1| Zinc finger protein ZAT3 [Morus notabilis] 62 1e-07 ref|XP_006345608.1| PREDICTED: zinc finger protein ZAT4-like [So... 62 1e-07 ref|XP_001758614.1| predicted protein [Physcomitrella patens] gi... 62 1e-07 gb|ADZ99348.1| C2H2 zinc finger protein [Gossypium hirsutum] 61 2e-07 >ref|XP_002970126.1| EPF-type Cis2-His2 zinc finger transcription factor [Selaginella moellendorffii] gi|300162637|gb|EFJ29250.1| EPF-type Cis2-His2 zinc finger transcription factor [Selaginella moellendorffii] Length = 646 Score = 67.4 bits (163), Expect = 3e-09 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 GGHECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNN 116 GGHECS+CH+VF +GQALGGHKRCHWVG ++N NN Sbjct: 513 GGHECSICHRVFATGQALGGHKRCHWVGG---SNNSNN 547 >ref|XP_002985202.1| EPF-type Cis2-His2 zinc finger transcription factor [Selaginella moellendorffii] gi|300147030|gb|EFJ13696.1| EPF-type Cis2-His2 zinc finger transcription factor [Selaginella moellendorffii] Length = 638 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 GGHECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNN 116 GGHECS+CH+VF +GQALGGHKRCHWV G ++N NN Sbjct: 510 GGHECSICHRVFATGQALGGHKRCHWV---GASNNSNN 544 >ref|XP_002984343.1| EPF-type Cis2-His2 zinc finger transcription factor [Selaginella moellendorffii] gi|300147731|gb|EFJ14393.1| EPF-type Cis2-His2 zinc finger transcription factor [Selaginella moellendorffii] Length = 868 Score = 65.9 bits (159), Expect = 7e-09 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +3 Query: 6 GHECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNNGKSLVS 134 GHECS+CH+VF SGQALGGHKRCHW G+ P S++ + +V+ Sbjct: 709 GHECSICHRVFTSGQALGGHKRCHWGGSDRPLSSEPPSQQVVA 751 >gb|ADE75910.1| unknown [Picea sitchensis] Length = 158 Score = 65.5 bits (158), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 6 GHECSVCHKVFQSGQALGGHKRCHWVGNR 92 GHECS+CHK+F SGQALGGHKRCHW G+R Sbjct: 34 GHECSICHKIFPSGQALGGHKRCHWTGDR 62 >gb|ESW32897.1| hypothetical protein PHAVU_001G026700g [Phaseolus vulgaris] Length = 220 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNNGKSLVSSNQ 143 HECS+CHK F +GQALGGHKRCH+ GN +N N S+V++++ Sbjct: 121 HECSICHKSFPTGQALGGHKRCHYEGNNNNNNNNGNSTSVVTASE 165 >ref|XP_002972767.1| EPF-type Cis2-His2 zinc finger transcription factor [Selaginella moellendorffii] gi|300159368|gb|EFJ25988.1| EPF-type Cis2-His2 zinc finger transcription factor [Selaginella moellendorffii] Length = 868 Score = 64.7 bits (156), Expect = 2e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 6 GHECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNK 110 GHECS+CH+VF SGQALGGHKRCHW G+ P S++ Sbjct: 709 GHECSICHRVFTSGQALGGHKRCHWGGSDRPLSSE 743 >gb|ACA52107.1| zinc finger protein ZFP248 [Arachis hypogaea] Length = 231 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNNGKSLVSSNQ 143 HECS+CHK F +GQALGGHKRCH+ G +N NN S V+S++ Sbjct: 168 HECSICHKSFPTGQALGGHKRCHYEGGNNNHNNNNNNSSAVASSR 212 >dbj|BAA19114.1| PEThy;ZPT4-1 [Petunia x hybrida] Length = 474 Score = 63.9 bits (154), Expect = 3e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNK 110 HECS+CH+VF +GQALGGHKRCHW+ + P S+K Sbjct: 300 HECSICHRVFSTGQALGGHKRCHWITSNSPDSSK 333 >ref|XP_002511650.1| conserved hypothetical protein [Ricinus communis] gi|223548830|gb|EEF50319.1| conserved hypothetical protein [Ricinus communis] Length = 480 Score = 63.5 bits (153), Expect = 4e-08 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNNGKSLVSSNQHWPNITSV 167 HECS+CH+VF SGQALGGHKRCHW+ TSN + SL +Q +I + Sbjct: 298 HECSICHRVFSSGQALGGHKRCHWI-----TSNSPDTSSLAKFHQFQDHIEQI 345 >ref|XP_002540465.1| conserved hypothetical protein [Ricinus communis] gi|223495541|gb|EEF21918.1| conserved hypothetical protein [Ricinus communis] Length = 230 Score = 63.5 bits (153), Expect = 4e-08 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNNGKSLVSSNQHWPNITSV 167 HECS+CH+VF SGQALGGHKRCHW+ TSN + SL +Q +I + Sbjct: 84 HECSICHRVFSSGQALGGHKRCHWI-----TSNSPDTSSLAKFHQFQDHIEQI 131 >emb|CAF74935.1| zinc finger DNA-binding protein [Catharanthus roseus] Length = 259 Score = 63.2 bits (152), Expect = 5e-08 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNNGKSLVSSNQ 143 HECS+CHK F SGQALGGHKRCH+ G G + N S V+S++ Sbjct: 158 HECSICHKCFPSGQALGGHKRCHYEGGAGAVGSTGNAASGVTSSE 202 >gb|EOX96331.1| C2H2-type zinc finger family protein [Theobroma cacao] Length = 477 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNNGKSLVSSNQ 143 HECS+CH+VF SGQALGGHKRCHW+ TSN + SL +Q Sbjct: 300 HECSICHRVFSSGQALGGHKRCHWI-----TSNSPDTSSLAKFHQ 339 >ref|XP_004240265.1| PREDICTED: uncharacterized protein LOC101264934 [Solanum lycopersicum] Length = 481 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNNGKSLVSSNQHWPNI 158 HECS+CH+VF +GQALGGHKRCHW+ TSN + S + N H I Sbjct: 296 HECSICHRVFSTGQALGGHKRCHWI-----TSNSPDSTSKFNFNGHMDQI 340 >emb|CBI16587.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 62.4 bits (150), Expect = 8e-08 Identities = 26/60 (43%), Positives = 37/60 (61%), Gaps = 4/60 (6%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNK----NNGKSLVSSNQHWPNITSVTPI 176 HECS+CH+VF SGQALGGHKRCHW+ + P ++ ++ + Q P + TP+ Sbjct: 206 HECSICHRVFSSGQALGGHKRCHWITSTAPDTSSLSKFHHFHDHLEQIQQRPKLPKTTPL 265 >ref|XP_002278612.1| PREDICTED: uncharacterized protein LOC100247922 [Vitis vinifera] Length = 467 Score = 62.4 bits (150), Expect = 8e-08 Identities = 26/60 (43%), Positives = 37/60 (61%), Gaps = 4/60 (6%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNK----NNGKSLVSSNQHWPNITSVTPI 176 HECS+CH+VF SGQALGGHKRCHW+ + P ++ ++ + Q P + TP+ Sbjct: 297 HECSICHRVFSSGQALGGHKRCHWITSTAPDTSSLSKFHHFHDHLEQIQQRPKLPKTTPL 356 >ref|XP_006445329.1| hypothetical protein CICLE_v10024047mg [Citrus clementina] gi|568875537|ref|XP_006490849.1| PREDICTED: zinc finger protein ZAT4-like [Citrus sinensis] gi|557547591|gb|ESR58569.1| hypothetical protein CICLE_v10024047mg [Citrus clementina] Length = 465 Score = 62.0 bits (149), Expect = 1e-07 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSN 107 HECS+CH+VF SGQALGGHKRCHW+ + P ++ Sbjct: 294 HECSICHRVFSSGQALGGHKRCHWITSNSPDAS 326 >gb|EXB37568.1| Zinc finger protein ZAT3 [Morus notabilis] Length = 549 Score = 61.6 bits (148), Expect = 1e-07 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSN 107 HECS+CH++F SGQALGGHKRCHW+ + P ++ Sbjct: 330 HECSICHRIFSSGQALGGHKRCHWITSNAPDTS 362 >ref|XP_006345608.1| PREDICTED: zinc finger protein ZAT4-like [Solanum tuberosum] Length = 479 Score = 61.6 bits (148), Expect = 1e-07 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTS 104 HECS+CH+VF +GQALGGHKRCHW+ + P S Sbjct: 294 HECSICHRVFSTGQALGGHKRCHWITSNSPDS 325 >ref|XP_001758614.1| predicted protein [Physcomitrella patens] gi|162690224|gb|EDQ76592.1| predicted protein [Physcomitrella patens] Length = 151 Score = 61.6 bits (148), Expect = 1e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRG 95 HECS+CH+VF SGQALGGHKRCHW G G Sbjct: 54 HECSICHRVFNSGQALGGHKRCHWSGGSG 82 >gb|ADZ99348.1| C2H2 zinc finger protein [Gossypium hirsutum] Length = 272 Score = 61.2 bits (147), Expect = 2e-07 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +3 Query: 9 HECSVCHKVFQSGQALGGHKRCHWVGNRGPTSNKNNGKS 125 H+CS+CHK F +GQALGGHKRCH+ G T+ NN KS Sbjct: 162 HKCSICHKSFPTGQALGGHKRCHYEGGNTTTTTNNNNKS 200