BLASTX nr result
ID: Ephedra28_contig00017610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00017610 (446 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK20994.1| unknown [Picea sitchensis] 81 2e-13 gb|EPS58641.1| hypothetical protein M569_16174 [Genlisea aurea] 55 1e-05 >gb|ABK20994.1| unknown [Picea sitchensis] Length = 52 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/53 (69%), Positives = 46/53 (86%) Frame = -1 Query: 317 MRESQAKVPIDNSWLVHYTPFIVVALILAHLIAFVYWIVRVAIEKPSERRKTH 159 MRE Q K+ +++SW+V Y PF+VVALI+AHL+AFVYWI RVA+EKP ERRKTH Sbjct: 1 MREVQKKI-VEHSWIVEYVPFMVVALIVAHLLAFVYWIYRVAMEKPPERRKTH 52 >gb|EPS58641.1| hypothetical protein M569_16174 [Genlisea aurea] Length = 52 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/53 (43%), Positives = 34/53 (64%) Frame = -1 Query: 317 MRESQAKVPIDNSWLVHYTPFIVVALILAHLIAFVYWIVRVAIEKPSERRKTH 159 M Q K PI W + + P ++V L++AH++A VYWI R+A +K +RRK H Sbjct: 1 MANFQQKAPI-RPWFIDFVPLMIVVLVVAHVLALVYWIYRLATDKQPQRRKVH 52