BLASTX nr result
ID: Ephedra28_contig00017233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00017233 (1478 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849425.1| hypothetical protein AMTR_s00024p00018770 [A... 65 1e-07 ref|XP_002518995.1| GTP-binding protein alpha subunit, gna, put... 62 5e-07 ref|XP_003631470.1| PREDICTED: uncharacterized protein LOC100248... 62 6e-07 ref|XP_006361258.1| PREDICTED: extra-large guanine nucleotide-bi... 61 1e-06 ref|XP_004244413.1| PREDICTED: uncharacterized protein LOC101267... 60 2e-06 gb|EOY21454.1| Extra-large GTP-binding protein 3 [Theobroma cacao] 60 3e-06 ref|XP_006352927.1| PREDICTED: extra-large guanine nucleotide-bi... 59 7e-06 ref|XP_002533449.1| GTP-binding protein alpha subunit, gna, put... 59 7e-06 >ref|XP_006849425.1| hypothetical protein AMTR_s00024p00018770 [Amborella trichopoda] gi|548853000|gb|ERN11006.1| hypothetical protein AMTR_s00024p00018770 [Amborella trichopoda] Length = 843 Score = 64.7 bits (156), Expect = 1e-07 Identities = 36/66 (54%), Positives = 44/66 (66%), Gaps = 5/66 (7%) Frame = -2 Query: 1222 EEKQE--WENMMREMFPHGYT---DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVP 1058 EEK E WE +++M PHG + E L+ SIAMEY GPPVPY PKVEPL + S +P Sbjct: 3 EEKDEKTWEGFLKKMLPHGASLPDHERLDYSIAMEYQGPPVPYDPPKVEPLDMS-SATIP 61 Query: 1057 TASLAQ 1040 ASLA+ Sbjct: 62 PASLAE 67 >ref|XP_002518995.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] gi|223541982|gb|EEF43528.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] Length = 1203 Score = 62.4 bits (150), Expect = 5e-07 Identities = 31/60 (51%), Positives = 40/60 (66%), Gaps = 4/60 (6%) Frame = -2 Query: 1219 EKQEWENMMREMFPHGYT----DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPTA 1052 E + W +M++M P G + D L+ SIA+EY GPPVPYK+PKVEPL V S +PTA Sbjct: 5 EGESWRELMKKMLPAGASLPEDDSKLDYSIAIEYEGPPVPYKVPKVEPLDVS-SQAIPTA 63 >ref|XP_003631470.1| PREDICTED: uncharacterized protein LOC100248864 [Vitis vinifera] Length = 863 Score = 62.0 bits (149), Expect = 6e-07 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 4/68 (5%) Frame = -2 Query: 1222 EEKQEWENMMREMFPHGYT--DE--DLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPT 1055 EE W M+ +M P G + DE DL+ SIA+EY GPPV YK+P VEPL V S +PT Sbjct: 2 EEGGNWREMVTKMLPPGASLPDEVSDLDYSIAIEYEGPPVSYKLPTVEPLDVN-SSAIPT 60 Query: 1054 ASLAQPLN 1031 AS+A+ L+ Sbjct: 61 ASIAETLS 68 >ref|XP_006361258.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Solanum tuberosum] Length = 850 Score = 60.8 bits (146), Expect = 1e-06 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 3/62 (4%) Frame = -2 Query: 1207 WENMMREMFPHG--YTDED-LECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPTASLAQP 1037 W M+R M P G + +ED + SIA EY GPP+ Y++P+VEP+ VK S +PTAS A+P Sbjct: 9 WREMVRRMLPPGVPFPEEDAMNYSIASEYTGPPISYELPRVEPVDVK-SGAIPTASTAEP 67 Query: 1036 LN 1031 L+ Sbjct: 68 LS 69 >ref|XP_004244413.1| PREDICTED: uncharacterized protein LOC101267543 [Solanum lycopersicum] Length = 850 Score = 60.1 bits (144), Expect = 2e-06 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 3/64 (4%) Frame = -2 Query: 1213 QEWENMMREMFPHG--YTDED-LECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPTASLA 1043 + W M+R M P G + +ED + SIA EY GPP+ Y++P+V+P+ VK S +PTAS A Sbjct: 7 ENWREMVRRMLPPGVPFPEEDAMNYSIASEYTGPPISYELPRVKPVDVK-SGAIPTASAA 65 Query: 1042 QPLN 1031 +PL+ Sbjct: 66 EPLS 69 >gb|EOY21454.1| Extra-large GTP-binding protein 3 [Theobroma cacao] Length = 864 Score = 59.7 bits (143), Expect = 3e-06 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 5/76 (6%) Frame = -2 Query: 1246 MDMDISGNEEKQEWENMMREMFPHG--YTDED-LECSIAMEYNGPPVPYKIPKVEP--LG 1082 M EE + WE+++R+M P G DED L+ SIA+EY GPP+PY +P+V+P LG Sbjct: 1 MAASTEAEEENKAWEDVIRKMLPVGAPLPDEDHLDYSIAVEYEGPPIPYDVPRVDPLDLG 60 Query: 1081 VKCSDDVPTASLAQPL 1034 + D+ + +A P+ Sbjct: 61 SLAASDLSSIPVAAPI 76 >ref|XP_006352927.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Solanum tuberosum] Length = 837 Score = 58.5 bits (140), Expect = 7e-06 Identities = 28/64 (43%), Positives = 40/64 (62%) Frame = -2 Query: 1222 EEKQEWENMMREMFPHGYTDEDLECSIAMEYNGPPVPYKIPKVEPLGVKCSDDVPTASLA 1043 +E + W M++ M P G E++E SIAMEY GP + Y++PKVEPL V S +A Sbjct: 4 KEGEHWREMVKRMLPQGGDGENIEYSIAMEYTGPLLSYEVPKVEPLDVNSS----AIPIA 59 Query: 1042 QPLN 1031 +PL+ Sbjct: 60 EPLS 63 >ref|XP_002533449.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] gi|223526698|gb|EEF28933.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] Length = 846 Score = 58.5 bits (140), Expect = 7e-06 Identities = 30/74 (40%), Positives = 47/74 (63%), Gaps = 3/74 (4%) Frame = -2 Query: 1240 MDISGNEEKQEWENMMREMFPHGYT---DEDLECSIAMEYNGPPVPYKIPKVEPLGVKCS 1070 +D EE++ WE ++R+M P G +E L+ SIA+EY GPP+ Y +P+V+P+ + S Sbjct: 4 VDTEAEEEEKAWEEVLRKMLPAGAPLPDEEHLDYSIAIEYQGPPISYDVPRVDPVNLS-S 62 Query: 1069 DDVPTASLAQPLNA 1028 V T+SLA +A Sbjct: 63 LSVRTSSLASVSHA 76