BLASTX nr result
ID: Ephedra28_contig00016820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00016820 (371 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006851048.1| hypothetical protein AMTR_s00025p00233290 [A... 55 7e-06 >ref|XP_006851048.1| hypothetical protein AMTR_s00025p00233290 [Amborella trichopoda] gi|548854719|gb|ERN12629.1| hypothetical protein AMTR_s00025p00233290 [Amborella trichopoda] Length = 406 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -2 Query: 106 GSHVPVMLSEVLRVFEGRQIRSFVDCTLGAGGHA 5 G HVPV+L E L VF R +RSFVDCT+GAGGH+ Sbjct: 68 GCHVPVLLGETLEVFRARNLRSFVDCTMGAGGHS 101