BLASTX nr result
ID: Ephedra28_contig00016317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00016317 (604 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE77560.1| unknown [Picea sitchensis] 57 5e-06 >gb|ADE77560.1| unknown [Picea sitchensis] Length = 187 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/44 (52%), Positives = 31/44 (70%) Frame = +2 Query: 2 GLLCWRTARASHRKRKHSRTQIRKSRYLLKLVVCAKCPCIKKSR 133 GLLCWR A+ + +K RT+ R+S+ L+LV CAKCPC+K R Sbjct: 144 GLLCWRMAKVNRKKGTRYRTRTRRSKLFLRLVPCAKCPCVKSIR 187