BLASTX nr result
ID: Ephedra28_contig00016209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00016209 (453 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004247046.1| PREDICTED: probable receptor protein kinase ... 58 3e-12 ref|XP_004502257.1| PREDICTED: probable receptor protein kinase ... 58 3e-12 ref|XP_003601704.1| Receptor-like kinase [Medicago truncatula] g... 58 3e-12 ref|XP_006296927.1| hypothetical protein CARUB_v10012920mg [Caps... 58 3e-12 gb|ESW35797.1| hypothetical protein PHAVU_001G265500g [Phaseolus... 58 3e-12 ref|XP_006418841.1| hypothetical protein EUTSA_v10002394mg [Eutr... 58 3e-12 ref|XP_002883458.1| leucine-rich repeat family protein [Arabidop... 58 3e-12 ref|NP_189017.1| leucine-rich repeat protein kinase-like protein... 58 3e-12 ref|XP_006601886.1| PREDICTED: probable receptor protein kinase ... 58 3e-12 gb|ACN59321.1| leucine-rich repeat receptor-like protein kinase ... 58 3e-12 ref|XP_003537524.1| PREDICTED: probable receptor protein kinase ... 58 3e-12 gb|EXB73709.1| putative receptor protein kinase TMK1 [Morus nota... 58 3e-12 gb|EMJ22502.1| hypothetical protein PRUPE_ppa001041mg [Prunus pe... 58 3e-12 ref|XP_006349904.1| PREDICTED: probable receptor protein kinase ... 58 3e-12 ref|XP_004252979.1| PREDICTED: probable receptor protein kinase ... 58 3e-12 ref|NP_001236021.1| Rhg4-like receptor kinase II precursor [Glyc... 58 3e-12 emb|CAN69461.1| hypothetical protein VITISV_043132 [Vitis vinifera] 58 3e-12 gb|ADO12863.1| leucine-rich repeat receptor-like kinase [Glycine... 58 3e-12 gb|ABD96565.1| Rhg4-like receptor kinase I [Glycine max] 58 3e-12 gb|ABD96567.1| Rhg4-like receptor kinase I [Glycine max] 58 3e-12 >ref|XP_004247046.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum lycopersicum] Length = 941 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSN+LLGDD AKV+DFGLVK+AP Sbjct: 709 FIHRDLKPSNVLLGDDMRAKVSDFGLVKNAP 739 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 742 KYSVETRLAGTFGYLAPEYA 761 >ref|XP_004502257.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer arietinum] Length = 933 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 710 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 740 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 743 KYSVETRLAGTFGYLAPEYA 762 >ref|XP_003601704.1| Receptor-like kinase [Medicago truncatula] gi|355490752|gb|AES71955.1| Receptor-like kinase [Medicago truncatula] Length = 933 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 710 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 740 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 743 KYSVETRLAGTFGYLAPEYA 762 >ref|XP_006296927.1| hypothetical protein CARUB_v10012920mg [Capsella rubella] gi|482565636|gb|EOA29825.1| hypothetical protein CARUB_v10012920mg [Capsella rubella] Length = 932 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 707 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 737 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 740 KYSVETRLAGTFGYLAPEYA 759 >gb|ESW35797.1| hypothetical protein PHAVU_001G265500g [Phaseolus vulgaris] Length = 931 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 709 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 739 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 742 KYSVETRLAGTFGYLAPEYA 761 >ref|XP_006418841.1| hypothetical protein EUTSA_v10002394mg [Eutrema salsugineum] gi|557096769|gb|ESQ37277.1| hypothetical protein EUTSA_v10002394mg [Eutrema salsugineum] Length = 931 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 704 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 734 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 737 KYSVETRLAGTFGYLAPEYA 756 >ref|XP_002883458.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297329298|gb|EFH59717.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 930 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 705 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 735 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 738 KYSVETRLAGTFGYLAPEYA 757 >ref|NP_189017.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gi|9293948|dbj|BAB01851.1| unnamed protein product [Arabidopsis thaliana] gi|332643288|gb|AEE76809.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] Length = 928 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 703 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 733 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 736 KYSVETRLAGTFGYLAPEYA 755 >ref|XP_006601886.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine max] Length = 928 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 706 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 736 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 739 KYSVETRLAGTFGYLAPEYA 758 >gb|ACN59321.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] Length = 928 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 703 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 733 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 736 KYSVETRLAGTFGYLAPEYA 755 >ref|XP_003537524.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine max] Length = 927 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 705 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 735 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 738 KYSVETRLAGTFGYLAPEYA 757 >gb|EXB73709.1| putative receptor protein kinase TMK1 [Morus notabilis] Length = 925 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 703 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 733 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 736 KYSVETRLAGTFGYLAPEYA 755 >gb|EMJ22502.1| hypothetical protein PRUPE_ppa001041mg [Prunus persica] Length = 925 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 702 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 732 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 735 KYSVETRLAGTFGYLAPEYA 754 >ref|XP_006349904.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum tuberosum] Length = 921 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 699 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 729 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 732 KYSVETRLAGTFGYLAPEYA 751 >ref|XP_004252979.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum lycopersicum] Length = 921 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 699 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 729 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 732 KYSVETRLAGTFGYLAPEYA 751 >ref|NP_001236021.1| Rhg4-like receptor kinase II precursor [Glycine max] gi|90655938|gb|ABD96568.1| Rhg4-like receptor kinase II [Glycine max] Length = 921 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 697 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 727 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 730 KYSVETRLAGTFGYLAPEYA 749 >emb|CAN69461.1| hypothetical protein VITISV_043132 [Vitis vinifera] Length = 921 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 698 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 728 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 731 KYSVETRLAGTFGYLAPEYA 750 >gb|ADO12863.1| leucine-rich repeat receptor-like kinase [Glycine max] Length = 920 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 695 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 725 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 728 KYSVETRLAGTFGYLAPEYA 747 >gb|ABD96565.1| Rhg4-like receptor kinase I [Glycine max] Length = 920 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 695 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 725 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 728 KYSVETRLAGTFGYLAPEYA 747 >gb|ABD96567.1| Rhg4-like receptor kinase I [Glycine max] Length = 920 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 FIHRDLKPSNILLGDDFCAKVTDFGLVKSAP 95 FIHRDLKPSNILLGDD AKV DFGLVK+AP Sbjct: 695 FIHRDLKPSNILLGDDMRAKVADFGLVKNAP 725 Score = 38.9 bits (89), Expect(2) = 3e-12 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 91 RHSIEIRLAGTFGYLAPEYA 150 ++S+E RLAGTFGYLAPEYA Sbjct: 728 KYSVETRLAGTFGYLAPEYA 747