BLASTX nr result
ID: Ephedra28_contig00016193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00016193 (536 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531984.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002531984.1| conserved hypothetical protein [Ricinus communis] gi|223528381|gb|EEF30420.1| conserved hypothetical protein [Ricinus communis] Length = 91 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 536 WVATFLIGWAAALQGHISWLKKQTDFQEKFGLL 438 W A+FLIGWAAALQGH+ WL++Q F++KFG L Sbjct: 13 WFASFLIGWAAALQGHMMWLQRQDSFKQKFGTL 45