BLASTX nr result
ID: Ephedra28_contig00016098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00016098 (524 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC31015.1| Cation/H(+) antiporter 20 [Morus notabilis] 55 7e-06 ref|XP_006485331.1| PREDICTED: cation/H(+) antiporter 1-like [Ci... 55 1e-05 >gb|EXC31015.1| Cation/H(+) antiporter 20 [Morus notabilis] Length = 858 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = +3 Query: 3 RTAQCPELGPIGDILASSDTQIKASVLIIQQHDEVSVHTDEVPHRKTVH 149 R A+ PELGPIGDILAS + +SVL+IQQHD VH +EVP + VH Sbjct: 782 RQAEHPELGPIGDILASPGRGVVSSVLVIQQHD--VVHAEEVPVSEVVH 828 >ref|XP_006485331.1| PREDICTED: cation/H(+) antiporter 1-like [Citrus sinensis] Length = 695 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = +3 Query: 12 QCPELGPIGDILASSDTQIKASVLIIQQHDEVSVHTDE 125 +CPELGP+GD+LASSD IK+SVLIIQQH + + +++E Sbjct: 653 ECPELGPVGDLLASSDLDIKSSVLIIQQHRQYTNNSNE 690