BLASTX nr result
ID: Ephedra28_contig00015982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00015982 (498 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006850275.1| hypothetical protein AMTR_s00020p00118800 [A... 56 4e-06 >ref|XP_006850275.1| hypothetical protein AMTR_s00020p00118800 [Amborella trichopoda] gi|548853896|gb|ERN11856.1| hypothetical protein AMTR_s00020p00118800 [Amborella trichopoda] Length = 340 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 2/64 (3%) Frame = +3 Query: 9 GDVSICFSDKIKRVEGKAFSCIAKLQWEKNSMTVPCDVFRIVCSPNEA--FYAWRFDVQA 182 G++ + ++ + + +FSC AK+QW N++ VPCDV+R VCS A +YAW+ D++A Sbjct: 276 GEMVVLWTREKLPLSSSSFSCRAKIQWSSNTLMVPCDVWR-VCSEPAAIYYYAWKLDLKA 334 Query: 183 ALSL 194 AL L Sbjct: 335 ALCL 338