BLASTX nr result
ID: Ephedra28_contig00015963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00015963 (411 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858247.1| hypothetical protein AMTR_s00062p00201720 [A... 59 7e-07 >ref|XP_006858247.1| hypothetical protein AMTR_s00062p00201720 [Amborella trichopoda] gi|548862350|gb|ERN19714.1| hypothetical protein AMTR_s00062p00201720 [Amborella trichopoda] Length = 421 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/97 (31%), Positives = 55/97 (56%) Frame = +3 Query: 3 GVSQGEVLRCFRIATGKATDVTNILKSSFEAYKTEREQKKIKRHKAPKASFVEDDFFKSA 182 GV Q E++RC R+A+ KATD+T+ +K + EAY ER Q+KI+RH + A K + Sbjct: 249 GVKQSEIMRCLRLASQKATDITDKIKKAVEAYDLERAQRKIRRHSSSSAQAACGADIKMS 308 Query: 183 AEMITAVAGESKIGVPEAKGVKVETGEILENKGMDED 293 +++ + KI G K+++ + + + ++ D Sbjct: 309 KQVVDVT--QKKI-----DGFKIQSKDPMNQEEVESD 338