BLASTX nr result
ID: Ephedra28_contig00015532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00015532 (606 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR17081.1| unknown [Picea sitchensis] 85 1e-14 >gb|ABR17081.1| unknown [Picea sitchensis] Length = 127 Score = 85.1 bits (209), Expect = 1e-14 Identities = 50/78 (64%), Positives = 56/78 (71%), Gaps = 7/78 (8%) Frame = -2 Query: 338 MEGLLPMVYRAIVQYKSGGQRIYGAFASSSPGDSGRLAWENAYMRLPGNDSGRLTSEFVE 159 MEGLLP VYRAIVQY+ QR+YGA AS PGDSGR +WE+AY+RLPG DSGR SE E Sbjct: 1 MEGLLPYVYRAIVQYRCS-QRLYGALAS--PGDSGRFSWESAYIRLPG-DSGRFASEIHE 56 Query: 158 -------SAQNIYRRSIS 126 S+Q IYRRS S Sbjct: 57 FIVEALPSSQTIYRRSAS 74