BLASTX nr result
ID: Ephedra28_contig00015106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00015106 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006290654.1| hypothetical protein CARUB_v10016746mg [Caps... 56 6e-06 >ref|XP_006290654.1| hypothetical protein CARUB_v10016746mg [Capsella rubella] gi|482559361|gb|EOA23552.1| hypothetical protein CARUB_v10016746mg [Capsella rubella] Length = 722 Score = 55.8 bits (133), Expect = 6e-06 Identities = 40/118 (33%), Positives = 60/118 (50%), Gaps = 3/118 (2%) Frame = -2 Query: 350 GHLENLKTLSVD-IGDLQALLESSGQLKCLSELFITDNCKNLERLPHSNDLLSIKDCPNL 174 G NLK L V L L S G L L+++ C +L LP S I D NL Sbjct: 340 GTATNLKKLYVSGCSSLLELPPSIGTATNLKRLYVS-GCSSLVNLPSS-----IGDLTNL 393 Query: 173 KEVDITNCESLKVI--DVRDLQSLRVFRVRSCPRLRNIMGLISLDGISLLEIQECMSL 6 KE+D++NC +L + + +LQ L R+R C +L + I+L+ + LL++ +C L Sbjct: 394 KELDLSNCSNLVELPSSIGNLQLLSYLRMRGCSKLEALPTNINLESLDLLDLTDCSQL 451