BLASTX nr result
ID: Ephedra28_contig00014972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00014972 (521 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002972002.1| hypothetical protein SELMODRAFT_96490 [Selag... 55 1e-05 >ref|XP_002972002.1| hypothetical protein SELMODRAFT_96490 [Selaginella moellendorffii] gi|302781524|ref|XP_002972536.1| hypothetical protein SELMODRAFT_97782 [Selaginella moellendorffii] gi|300160003|gb|EFJ26622.1| hypothetical protein SELMODRAFT_97782 [Selaginella moellendorffii] gi|300160301|gb|EFJ26919.1| hypothetical protein SELMODRAFT_96490 [Selaginella moellendorffii] Length = 231 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = +3 Query: 3 EFEGKLKVKDWISKLKSTKVNGELANHCCHQLPLDLETSYNAFMDSLPR 149 +FEGK+K +DWI+KL + EL QL DL++SYNAF++SLP+ Sbjct: 181 DFEGKVKTRDWIAKLNKMGASDELTEQQARQLLFDLDSSYNAFINSLPK 229