BLASTX nr result
ID: Ephedra28_contig00014961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00014961 (768 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843053.1| hypothetical protein AMTR_s00186p00022000 [A... 70 6e-10 ref|XP_006843052.1| hypothetical protein AMTR_s00186p00021680 [A... 57 9e-06 >ref|XP_006843053.1| hypothetical protein AMTR_s00186p00022000 [Amborella trichopoda] gi|548845252|gb|ERN04728.1| hypothetical protein AMTR_s00186p00022000 [Amborella trichopoda] Length = 123 Score = 70.5 bits (171), Expect = 6e-10 Identities = 28/78 (35%), Positives = 46/78 (58%) Frame = +2 Query: 428 VTGTSLHRNAVKKFRSHLDCFSESGKWIYNSTARHIPWNYAGDQYASQCDGKHSSVKGNA 607 + GT + +++ KFR HL C SESG+W+Y+ R IPWN+ +QY+ +C+ +H ++G Sbjct: 44 IQGTPVLGHSIDKFRDHLRCISESGRWVYDPMPRQIPWNHVAEQYSERCEERHPGLRGEG 103 Query: 608 VGDWAEILASHPEYGNWT 661 I ++ NWT Sbjct: 104 ------IAGTYYSTANWT 115 >ref|XP_006843052.1| hypothetical protein AMTR_s00186p00021680 [Amborella trichopoda] gi|548845251|gb|ERN04727.1| hypothetical protein AMTR_s00186p00021680 [Amborella trichopoda] Length = 166 Score = 56.6 bits (135), Expect = 9e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +2 Query: 662 VREELKWVWRTNNSCPIIPIDRIAFCKLIGAYG 760 VREELKWVW+++NSCP +P+DR +CKL+GA G Sbjct: 9 VREELKWVWQSSNSCPTLPVDRNDWCKLLGAKG 41