BLASTX nr result
ID: Ephedra28_contig00014878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00014878 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN40108.1| unknown [Picea sitchensis] 61 2e-07 gb|ABK24348.1| unknown [Picea sitchensis] 61 2e-07 gb|EMT19150.1| Vesicle-associated membrane protein-associated pr... 57 2e-06 gb|EMS46852.1| Vesicle-associated protein 4-2 [Triticum urartu] 57 2e-06 gb|AFB33321.1| hypothetical protein 2_3265_02, partial [Pinus ce... 57 3e-06 dbj|BAJ98837.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 3e-06 ref|NP_001150389.1| LOC100284019 [Zea mays] gi|195638878|gb|ACG3... 56 4e-06 ref|XP_006593058.1| PREDICTED: vesicle-associated protein 4-2-li... 55 7e-06 ref|XP_003527459.1| PREDICTED: vesicle-associated protein 4-2-li... 55 7e-06 gb|ACU23748.1| unknown [Glycine max] 55 7e-06 >gb|ACN40108.1| unknown [Picea sitchensis] Length = 195 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/43 (69%), Positives = 39/43 (90%), Gaps = 2/43 (4%) Frame = +3 Query: 6 QARKKPQDN-ASKPAAP-DGVIDEWKERRERYLARQQEELVDS 128 QA+KKPQ+N A+K AAP +GVIDEW++RRE+YLARQQE++ DS Sbjct: 152 QAQKKPQNNKAAKVAAPTEGVIDEWRDRREKYLARQQEDIADS 194 >gb|ABK24348.1| unknown [Picea sitchensis] Length = 253 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/43 (69%), Positives = 39/43 (90%), Gaps = 2/43 (4%) Frame = +3 Query: 6 QARKKPQDN-ASKPAAP-DGVIDEWKERRERYLARQQEELVDS 128 QA+KKPQ+N A+K AAP +GVIDEW++RRE+YLARQQE++ DS Sbjct: 210 QAQKKPQNNKAAKVAAPTEGVIDEWRDRREKYLARQQEDIADS 252 >gb|EMT19150.1| Vesicle-associated membrane protein-associated protein A [Aegilops tauschii] Length = 229 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +3 Query: 6 QARKKPQDNASKPAAPDG-VIDEWKERRERYLARQQEELVDS 128 +ARKKP ++ S P +G VIDEWKERRERYLARQQ E VDS Sbjct: 187 EARKKPPEDTSPPIVGEGLVIDEWKERRERYLARQQVEEVDS 228 >gb|EMS46852.1| Vesicle-associated protein 4-2 [Triticum urartu] Length = 229 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +3 Query: 6 QARKKPQDNASKPAAPDG-VIDEWKERRERYLARQQEELVDS 128 +ARKKP ++ S P +G VIDEWKERRERYLARQQ E VDS Sbjct: 187 EARKKPPEDTSPPIVGEGLVIDEWKERRERYLARQQVEEVDS 228 >gb|AFB33321.1| hypothetical protein 2_3265_02, partial [Pinus cembra] gi|376337501|gb|AFB33322.1| hypothetical protein 2_3265_02, partial [Pinus cembra] gi|376337503|gb|AFB33323.1| hypothetical protein 2_3265_02, partial [Pinus cembra] Length = 48 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/40 (72%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = +3 Query: 3 HQARKKPQD-NASKPAAP-DGVIDEWKERRERYLARQQEE 116 +QARKKPQD NA K AP +GV+DEWK+RRE+YLARQQ E Sbjct: 6 NQARKKPQDDNAPKSTAPVEGVLDEWKDRREKYLARQQVE 45 >dbj|BAJ98837.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 229 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +3 Query: 6 QARKKPQDNASKPAAPDG-VIDEWKERRERYLARQQEELVDS 128 +ARKKP ++ S P +G VIDEWKERRERYLARQQ E VDS Sbjct: 187 EARKKPPEDNSPPIVGEGLVIDEWKERRERYLARQQVEEVDS 228 >ref|NP_001150389.1| LOC100284019 [Zea mays] gi|195638878|gb|ACG38907.1| structural molecule [Zea mays] gi|413917466|gb|AFW57398.1| structural molecule [Zea mays] Length = 229 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +3 Query: 6 QARKKP-QDNASKPAAPDGVIDEWKERRERYLARQQEELVDS 128 +ARKKP +DN ++ VIDEWKERRERYLARQQEE VDS Sbjct: 187 EARKKPPEDNGTRIVGEGLVIDEWKERRERYLARQQEEGVDS 228 >ref|XP_006593058.1| PREDICTED: vesicle-associated protein 4-2-like [Glycine max] Length = 298 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +3 Query: 6 QARKKPQDNASKPAAPDG-VIDEWKERRERYLARQQEELVDS 128 +ARKKP + A +G VIDEWKERRERYLARQQ E+VDS Sbjct: 256 EARKKPPEETGPRVAGEGLVIDEWKERRERYLARQQVEVVDS 297 >ref|XP_003527459.1| PREDICTED: vesicle-associated protein 4-2-like [Glycine max] Length = 271 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +3 Query: 6 QARKKPQDNASKPAAPDG-VIDEWKERRERYLARQQEELVDS 128 +ARKKP + A +G VIDEWKERRERYLARQQ E+VDS Sbjct: 229 EARKKPPEETGPRVAGEGLVIDEWKERRERYLARQQVEVVDS 270 >gb|ACU23748.1| unknown [Glycine max] Length = 265 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +3 Query: 6 QARKKPQDNASKPAAPDG-VIDEWKERRERYLARQQEELVDS 128 +ARKKP + A +G VIDEWKERRERYLARQQ E+VDS Sbjct: 223 EARKKPPEETGPRVAGEGLVIDEWKERRERYLARQQVEVVDS 264