BLASTX nr result
ID: Ephedra28_contig00014268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00014268 (659 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlise... 59 2e-06 >gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlisea aurea] Length = 61 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 239 WILLGIDFSRLFWVLFGLFSYENHEGKPRI 150 WI+L ID+SRL W+LFG+FSYENHEGKPRI Sbjct: 31 WIMLRIDYSRLSWLLFGVFSYENHEGKPRI 60